CAZyme Information: MGYG000000238_00458

Basic Information

• Species: Enterococcus_D casseliflavus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D casseliflavus
• CAZyme ID: MGYG000000238_00458
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
751	MGYG000000238_1|CGC10	86198.24	6.514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000238	3499694	Isolate	China	Asia

• Gene Location: Start: 480061; End: 482316 Strand: +

Full Sequence      

MEQKRLPWAKKVVYFLAFVFSLIYLSWRGLYTLPWHESWFALLFGLLLWGSEIVSNFTGL
LLIWNKNKAKPFEKPIVPEADYPAIDVLIATHNEEVPLLLKTVNAAVHMKYPDPKKVHIY
LSDDTNRPEVKALADKFGIGYIGLTGNQHAKSGNLNHALSKTNSPLVATFDADMIPYSDF
LLETVPYFVANQQERRKDQTIKPLGFVQTPQSFYNADLFQYNLFSEAAIPNEQDFFSREV
NVLNNAHDTAIYTGSNTVIAREAIEAAGGFPTDTITEDFELGALINCQGYRSLSTLKPMA
SGLSPIDIPSALKQRIRWGRGVVQSVHNLHLFKNKTLSLAQKMVFLNSYLYWWSFLRRLL
FIFAPILYTVFNVRVVETNFWVLLLFWLPSYTFLHLAMQDLSSDIRTQRWGEIQETIFAP
YLVIPVFLQAIGIKETRFKVTNKAATQSKKDLLFVVPHLLLLILTIIGLVKFNYGKFGSE
IFYGSVLTFWLLTHFFNLTFAVLFYLGRPIYRTTERFRAHYPVEVSDQDASYSLMTENIS
ENGLSFVSDVPLYFPPDAQLTFKITRNGYQAEMTGNVVRVFSGKDRWVYGVALHQLSEKD
YLAYLQIIYDGFNQSLPVLRDPWMTFFDSLFENLGKHLLQAKQKPLPPQRVPVLSIDQEW
VFEEGAYTVTTFGFDQLTLVKTEEVEMPARLTLPFSNLVLHAEKATLQPTENQVIYQVSN
LSELRFTAAFQEWVDSLLRKEEDDDRDPAAI

Enzyme Prediction     

No EC number prediction in MGYG000000238_00458.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	86	265	8.8e-20	0.9764705882352941
GT2	204	371	8.9e-17	0.7563451776649747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	3.11e-81	83	324	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.17e-61	16	443	192	609	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	3.46e-41	38	445	11	380	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06437	CESA_CaSu_A2	1.79e-26	83	321	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
cd06435	CESA_NdvC_like	3.04e-25	92	324	7	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG30225.1	0.0	1	751	4	754
AYJ46610.1	0.0	1	751	4	754
QGN28684.1	0.0	1	751	4	754
EEV37932.2	0.0	1	751	1	751
ATF71163.1	0.0	1	751	4	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	5.69e-57	16	633	205	806	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	5.53e-51	24	449	68	502	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.13e-50	24	449	80	514	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.14e-50	24	449	81	515	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6WLB_A	7.99e-08	253	496	651	935	Structureof homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides],6WLB_B Structure of homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides],6WLB_C Structure of homotrimeric poplar cellulose synthase isoform 8 [Populus tremula x Populus tremuloides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P58931	1.37e-57	16	578	91	649	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q8X5L7	1.11e-56	16	633	205	806	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
Q93IN2	1.13e-56	16	633	205	806	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P37653	2.77e-56	16	633	205	806	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q8Z291	9.58e-56	16	633	205	806	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000016	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	31
41	63
349	371
375	397
410	432
452	474
481	503