CAZyme Information: MGYG000000238_01267

Basic Information

• Species: Enterococcus_D casseliflavus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D casseliflavus
• CAZyme ID: MGYG000000238_01267
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208		24335.6	4.4072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000238	3499694	Isolate	China	Asia

• Gene Location: Start: 27419; End: 28045 Strand: -

Full Sequence      

MIPKIIHYCWFGGNPLGEQEKKYMDTWKKYCPDYEIKRWDESTIDLSKFGPYLKEAYDQE
EWAFVSDVVRLYALVTEGGIYMDTDIEVVKPLDELLTLEAFMGFEIETKISTGIIGAVPH
HPFMEEWYHDYDDRKFVRAEKTEDVVTNVIRVTELLQNHGLELNNQRQTVKGVEIFPQMT
FSPKSYITGEVEEDPSTMVIHQFSGSWL

Enzyme Prediction     

No EC number prediction in MGYG000000238_01267.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	19	96	1.3e-22	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	9.78e-22	1	123	81	206	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.41e-14	17	101	1	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	3.17e-07	1	131	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	5.85e-05	4	43	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.003	52	85	160	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF71246.1	1.86e-159	1	208	1	208
AYJ45014.1	1.86e-159	1	208	1	208
QOG31826.1	1.86e-159	1	208	1	208
EEV40457.2	1.86e-159	1	208	1	208
QGN30540.1	1.86e-159	1	208	1	208

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38287	6.99e-11	1	124	61	186	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q10323	7.65e-10	2	124	57	181	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
P33300	4.97e-09	1	124	54	179	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
Q14BT6	6.19e-09	45	161	128	245	Alpha-1,4-N-acetylglucosaminyltransferase OS=Mus musculus OX=10090 GN=A4gnt PE=2 SV=1
Q9UNA3	3.81e-08	35	152	120	234	Alpha-1,4-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=A4GNT PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000238_01267.