CAZyme Information: MGYG000000238_01534

Basic Information

• Species: Enterococcus_D casseliflavus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D casseliflavus
• CAZyme ID: MGYG000000238_01534
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
305	MGYG000000238_6|CGC4	34219.97	7.2128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000238	3499694	Isolate	China	Asia

• Gene Location: Start: 119098; End: 120015 Strand: -

Full Sequence      

MDRISKTTPPIKLKVSKEPQKGDFTSIQAAVLAAEALNVPCEITIASGVYQEQVKIYKNQ
LTLIAEPNTFLCYHLAAEQIDENGQKRGTFQTATLFINSREVFVKNLTIINDAGYGQAVG
QAVAVYIEGDDIRFERCHLDAFQDTLCLGPLPKYTKEGEPMISPWRKTIFDQQQSLFLHC
RISGTVDFIFGGGSATFEECRLHCKNTPQTNYITAASTSKQASGLTFDRCRVTGDKAYHL
GRPWRNDAKVTFLSCCFDQQLTPCGWSDWGKTASHQTVIFTERMCCYQTSPKRPEWVTIE
GVIEK

Enzyme Prediction     

No EC number prediction in MGYG000000238_01534.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	17	296	1.7e-68	0.9131944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02682	PLN02682	3.02e-44	6	285	64	330	pectinesterase family protein
PLN02773	PLN02773	1.91e-38	13	285	7	265	pectinesterase
COG4677	PemB	4.09e-38	15	271	85	360	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.46e-38	21	269	9	245	Pectinesterase.
PLN02665	PLN02665	3.26e-35	10	285	67	323	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG31224.1	3.42e-233	1	305	1	305
AYJ45554.1	5.23e-228	1	305	1	305
AUJ85241.1	6.10e-227	1	305	1	305
AMG50375.1	3.53e-226	1	305	1	305
EEV39840.1	1.01e-225	1	305	1	305

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	5.91e-25	15	244	35	269	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	7.55e-23	15	244	8	245	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	9.30e-21	22	282	17	265	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.25e-20	22	284	13	263	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1QJV_A	5.82e-17	15	244	8	245	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8VYZ3	1.88e-29	5	285	77	344	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LVQ0	1.19e-28	22	285	15	265	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	3.00e-26	10	284	253	517	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9ZQA3	6.12e-26	22	285	99	348	Probable pectinesterase 15 OS=Arabidopsis thaliana OX=3702 GN=PME15 PE=2 SV=1
Q4PT34	2.63e-25	22	267	54	287	Probable pectinesterase 56 OS=Arabidopsis thaliana OX=3702 GN=PME56 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000238_01534.