CAZyme Information: MGYG000000238_02648

Basic Information

• Species: Enterococcus_D casseliflavus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D casseliflavus
• CAZyme ID: MGYG000000238_02648
• CAZy Family: CBM70
• CAZyme Description: Hyaluronate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1066	MGYG000000238_15|CGC3	121729.74	4.5193

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000238	3499694	Isolate	China	Asia

• Gene Location: Start: 74854; End: 78054 Strand: -

Full Sequence      

MKNKIVVKSLFVLALLTSTSLNALAEEPESVNEAEQSIDKTVIQSDDNQGNSNLVQNGDF
SNIESQEGKWSGNKPSSWGIWIPRDMTSADYTAEVNANNQIVLSSLKDDFRVGITQKIEV
DPNKLYQLSFKVKTDELTNVARVRINEQNENGQTNLWYSKSVKGTTDWQTITQDFEPNPE
TSFVTIELFFEKGIGTLYYDDVSFLEKQIEEDDGITIEDKIEINTNNIYVTKQENYKYVV
SDSSLATEEEGMLYPVKEGETTVKILDEKGIFMMEIPLVISSYNETKFNKMLNQWNGIIA
GNSYYNDNNHVMVQQNKDLDSSVENIISLYTYKENFKTLWSDITDYKVSANITESYRRIE
TISKQVTQPASKYYQDKEVIRIAKNAMEWMSKNVYNENSSLQGNWWDYEIGAPRAINNTL
SLMQAYFTQSEILMYTNPINYFVPDPYNFRVTLGTPFKALGGNLVDMGRVKIISGALRED
GDIVSKSVESLQQAFEYAKPGESGFYEDGSYIDHDNVALTGAYGSVLIDGLSQLLPVVLE
SELLPVSKLDNLYNFIENSFIPLMYKGEMMDMVRGRAVSREELQSHAAGGEVLRGLMRVA
NSSEETQKNRLNKLVKTFVKGNTYYDIYDSLNSYKDIDLMDKLLADDSISITDFSTSLAT
FNEMDKVAYQNVNAKFGIGVSMYSDTTQNYEYMNEENSHGWYTSDGAVYLYNLDLSHYND
NYWATVDPYHIPGTTIIPTERKDGSGMVRSPNSFIGATKLDDTTASIVMEFTNWDKTLNA
NKSWFIFNDKVVFLGSDIQTTGDTQPITTIENRKNTDTTQYDVYVNGDKQILNNEKVELK
NVHSLLLSSPNNQAMNIGYIFLDKTSLDFLNKTNQGRWKDINASQSDQLHENNFLTFYKT
HSKEDTRYAYVMYPNVSNDELAKKEESNKVKILQNNASVQAVYDADEESWGVVLYEDMPF
EIDGAITLTKKGVYSIKKKDEYRVSYFNPSDEEYHSDTIETILSQEIVQEATNKDKSTII
RLSIDKDTRKALKDKQKEKEKQAEKDKQKKENQLEKEKRAKRNKNL

Enzyme Prediction     

EC	4.2.2.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	660	917	2.3e-101	0.9962825278810409
CBM70	53	206	7.8e-45	0.9751552795031055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	288	989	2	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam08124	Lyase_8_N	6.84e-117	295	617	1	323	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02278	Lyase_8	6.04e-73	661	917	4	252	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	8.11e-06	933	990	1	60	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG29929.1	0.0	1	1066	1	1066
QZN88139.1	0.0	4	1038	2	1027
QCX17614.1	0.0	53	1024	120	1093
QNL42711.1	1.30e-282	39	989	63	1015
AGU84133.1	1.84e-282	39	989	63	1015

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1OJM_A	2.11e-231	292	993	9	710	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1C82_A	2.26e-231	292	993	11	712	MechanismOf Hyaluronan Binding And Degradation: Structure Of Streptococcus Pneumoniae Hyaluronate Lyase In Complex With Hyaluronic Acid Disaccharide At 1.7 A Resolution [Streptococcus pneumoniae],1EGU_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase At 1.56 A Resolution [Streptococcus pneumoniae],1F9G_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase Cocrystallized With Ascorbic Acid [Streptococcus pneumoniae],1OJP_A Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae],1W3Y_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin C [Streptococcus pneumoniae],2BRP_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with W249b [Streptococcus pneumoniae],2BRV_X Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate. [Streptococcus pneumoniae],2BRW_A Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae],2BRW_B Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae]
1LOH_A	6.43e-231	292	993	9	710	ChainA, Hyaluronate Lyase [Streptococcus pneumoniae],1LXK_A Chain A, Hyaluronate Lyase [Streptococcus pneumoniae]
1OJN_A	9.02e-231	292	993	11	712	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex Of The Tyr408phe Mutant With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1OJO_A	1.27e-230	292	993	11	712	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex Of The Tyr408phe Mutant With 4-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54873	2.86e-275	53	993	54	996	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q53591	3.84e-244	51	989	11	973	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q59801	3.42e-148	275	1018	36	795	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
Q9AQS0	4.35e-61	339	953	80	682	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
P0CZ01	5.51e-50	352	945	104	696	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000295	0.998903	0.000303	0.000182	0.000155	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000238_02648.