CAZyme Information: MGYG000000238_02694

Basic Information

• Species: Enterococcus_D casseliflavus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D casseliflavus
• CAZyme ID: MGYG000000238_02694
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1023	MGYG000000238_16|CGC1	118491.47	6.0196

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000238	3499694	Isolate	China	Asia

• Gene Location: Start: 35644; End: 38715 Strand: +

Full Sequence      

MEPLVSVIITCYNHEKYVGQCLESVSSQTYKHLELVIINDGSTDNSDQIIRDYLSHVSLK
HEYLVQENRGVCVTRNKGLERAVGKYLLFVDSDNYLDNQYIEKLVETAEKEEADIVYTDL
VNVETGELFMEAKPFQLEEFLSSNFIDNCSLIRKEIVGQLTYDLALNRKKLVDYDFFMRL
ILTNHAKAVKCSSTKLNYRVLQESISRKGQHGTEKFYYEIYLYLLSKHQEQYPQLVLSAI
KNNIMQLEDRNEDLINHLADLTNYIKQQNKDNELLLAEVNELKVSVEDLNNEKQAIDQRL
REENLEKNDLQNQNLSMAQLIQLLENDKQALMSSKSYRVGKLIVKPFSYGLRFLRNPSKG
LVLVDKAKQKLLVKLRKIPNLQFLVLSSKRKATRKKNVYQNPKRVLVYVIYESQSQLQEY
KLIFLSSLADFSEKVLIVVNGKLPESDLEKLRKFGEVVLRSNDGYDTAAFKHGINFLGEK
ELSKYDELLLVNDTNVGPVSDLTEAFNKMAAKKLDFWGISYGEEQPDFTKYNKYGYIPIH
LQSYFLVIEKSMFHDPSFYDYWKNLGDTNSREKAIGKHETVFTKHFSDLGFKHGALTEKN
TDSPMYIHPLQMVREGVPIVKYTAFANDTDEKFAWQGLQRKTEVPELIEYIRNETEYPGA
VINQIMEDIKNKKHKEHILIIDGVENAIPQLTKYRVQNKIEQLKNLGFDVWHVNLSTFQM
GLAEHASHIIIYRAPYDERLAELIRLARKYHKPVLYDIDDLVIDTKYTDQLTYVQNLTKV
EKNNYDSGVISYKKMMLMCDGAIASTGVLKEELLNYHQNVLLNRNLANQELVAISDDAVE
NKMEDSTKVKIGYFSGSITHNENFELIKPAILEILETFPQVELHLVGHLDVPKEMERVES
QLVIHPFVDWKELPKLICQVDINLAPLVHSIFNEAKSEIKWMEAALVKIPTLASEIGAFK
EMVTHNRNGILVKDNEWFNQLEKVINDKTFRETIGENAYNYVIENCTTSEHEDELSAFLR
SIH

Enzyme Prediction     

No EC number prediction in MGYG000000238_02694.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	133	3.4e-32	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05045	RgpF	2.08e-53	435	671	1	240	Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.
COG3754	RgpF	1.02e-45	403	658	2	255	Lipopolysaccharide biosynthesis protein [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	1.13e-32	7	118	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.90e-31	6	157	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03794	GT4_WbuB-like	1.06e-28	728	1008	100	383	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG31425.1	0.0	1	1023	1	1023
AMG50194.1	0.0	1	1023	1	1023
AYJ45369.1	0.0	4	1019	3	1014
QGN30122.1	0.0	4	1019	3	1014
QIW57567.1	0.0	1	1015	1	980

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.29e-21	4	115	6	116	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	9.19e-18	3	173	5	184	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6P61_A	5.74e-15	3	138	13	148	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
2Z86_A	1.88e-13	3	209	375	602	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	1.88e-13	3	209	374	601	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.89e-20	1	115	3	116	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
P71057	3.76e-20	3	116	4	115	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
A0A0H2UR96	1.67e-18	1	162	1	182	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71059	2.38e-18	1	116	1	115	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
Q57022	3.34e-17	3	153	4	147	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000238_02694.