CAZyme Information: MGYG000000240_00153

Basic Information

• Species: Amedibacterium intestinale
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Amedibacterium; Amedibacterium intestinale
• CAZyme ID: MGYG000000240_00153
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		54568.39	5.1418

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000240	2625986	Isolate	China	Asia

• Gene Location: Start: 128735; End: 130207 Strand: -

Full Sequence      

MKIRRIIIAIVVILLIASCISIPMFAQESADNVEKQQYVNHDFDDVEIVTEDTYVPVDTK
VPKEMNDNAVLGSALEKEPQTYAVEAKAKDPEWKLENGNKNFYNGYGELMYHQGTQKVID
VSEHNGKIDWEKVKQSGIDGAILRVGYGNRMEDKYFKRNIEECNRLGIPYGIYLYSYAYD
ENFAYAEAEGTVEMLSKYHVNLSYPIFYDIEAFDSWNDGGVTRRHPTTVAEYEKVIGTYL
DYMNKNGYAGKVHVYSYRSYANGVLNSPAIHSNLSWVAEYGPKLNFKNKHYAGEQGWQYT
SSGSVNGIKGRVDLNCFSSKFYNKPVSENVPVAVSDALTRAGVRFSGGYLSGMQVGTNLD
TLIKELSSVGSVTCFDKNGAIVNGGSITTGTTIDVTISLPEESSSVEAGETPTLAKTQTY
TMMIVLKGDVDGDGRIRSIDYSLVKNDILNIRKLSSAFFLAGDVDGDGKIRSIDYSLIKN
DILNIRKITQ

Enzyme Prediction     

No EC number prediction in MGYG000000240_00153.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	119	308	2.8e-37	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	2.07e-70	116	317	1	190	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	1.44e-34	117	315	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	6.19e-25	117	317	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06523	GH25_PlyB-like	2.59e-21	117	315	1	175	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	4.21e-21	119	308	1	180	Glycosyl hydrolases family 25.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK23561.1	0.0	1	460	1	460
BBK63284.1	0.0	1	460	1	460
BCT44110.1	2.88e-93	1	445	1	452
QQR24886.1	5.19e-82	40	319	32	315
ANU71242.1	5.19e-82	40	319	32	315

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	4.62e-58	85	315	238	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	1.26e-57	85	315	238	465	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRU_A	7.83e-17	117	322	21	212	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.31e-16	117	347	21	238	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
5A6S_A	2.65e-06	116	321	22	205	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26836	1.38e-11	117	320	10	199	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	9.24e-11	117	318	2	181	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002282	0.343957	0.651549	0.000956	0.000769	0.000483

TMHMM  Annotations     

start	end
7	26