CAZyme Information: MGYG000000240_01613

Basic Information

• Species: Amedibacterium intestinale
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Amedibacterium; Amedibacterium intestinale
• CAZyme ID: MGYG000000240_01613
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000000240_29|CGC1	53670.96	5.7359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000240	2625986	Isolate	China	Asia

• Gene Location: Start: 3424; End: 4827 Strand: -

Full Sequence      

MFYKQLKAFPEGFLWGASTSAYQVEGAYKEDGKGLSVQDLHEPKDIADFKVASDHYHHMK
EDVKLMAEMGMKAYRFSIAWTRILPDGDGEVNEKGIQFYNELIDELVSYGIEPVVTMYHF
DLPLKLHEKGGWCSRNTIDAFVKYAKILFETYGDRVKYWLTINEQNVMINHPNAMNPGRI
PTKKELYQQCHNMFVAAAKATILCHEMVSNGKIGPAPNITAIYPEKCNPADVIAADNWES
IRCWLYLDVAVHGRYNSIAWVYMEEKGYTPVIEDGDMEIIAKAKPDFIGVNYYATATVSE
ARNDGTDCQPRNGDQQVMIGEEGVYRAAKNNYLEETQFGWLIDSIGMRVTLRRIYDRYHL
PMLITENGLGAKDKLTEDGCVHDPYRIDYLKRHFHQAQLAISDGVELIGYCPWSFIDLVS
THQGYGKRYGFVYVNRDEKDLKNMARIKKDSFYWYQEVIKNNGLSEE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	7	463	5.2e-155	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	6	467	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	1.55e-177	9	463	5	452	Glycosyl hydrolase family 1.
TIGR03356	BGL	1.03e-147	10	455	1	426	beta-galactosidase.
PRK09589	celA	4.44e-134	9	463	4	473	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.02e-132	9	463	4	470	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK21978.1	0.0	1	467	1	467
BBK62060.1	0.0	1	467	1	467
QQV04599.1	4.02e-316	1	464	1	465
QMW73981.1	4.02e-316	1	464	1	465
QPS12751.1	4.02e-316	1	464	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7M1R_A	1.78e-168	1	463	3	477	ChainA, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_B Chain B, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_C Chain C, 6-phospho-beta-galactosidase [Bacillus licheniformis],7M1R_D Chain D, 6-phospho-beta-galactosidase [Bacillus licheniformis]
4ZE4_A	1.38e-161	4	463	11	482	Structureof Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZE4_B Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZEN_A Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],4ZEN_B Structure of Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],4ZEP_A Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose [Geobacillus stearothermophilus],4ZEP_B Structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-glucose [Geobacillus stearothermophilus],5OKB_A High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_B High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_C High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKB_D High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKH_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKH_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKJ_A Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKJ_B Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in the C2 spacegroup [Geobacillus stearothermophilus],5OKK_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKK_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKQ_A Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKQ_B Non-conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-galactose [Geobacillus stearothermophilus],5OKR_A Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKR_B Conservatively refined structure of Gan1D-WT, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKS_A Non-conservatively refined structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus],5OKS_B Non-conservatively refined structure of Gan1D, a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with 6-phospho-beta-glucose [Geobacillus stearothermophilus]
4ZE5_A	3.92e-161	4	463	11	482	Structureof Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZE5_B Structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZE5_C Structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZE5_D Structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4ZFM_A Structure of Gan1D-E170Q in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],4ZFM_B Structure of Gan1D-E170Q in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],4ZFM_C Structure of Gan1D-E170Q in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],4ZFM_D Structure of Gan1D-E170Q in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OK7_A Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OK7_B Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OK7_C Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OK7_D Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKA_A Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKA_B Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKA_C Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKA_D Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a 6-phospho-beta-galactosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5OKE_A Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKE_B Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKE_C Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKE_D Conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKG_A Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKG_B Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKG_C Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus],5OKG_D Non-conservatively refined structure of Gan1D-E170Q, a catalytic mutant of a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus, in complex with cellobiose-6-phosphate [Geobacillus stearothermophilus]
6Z1H_A	1.17e-127	4	467	7	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]
6WGD_A	6.44e-127	4	465	3	468	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42403	8.78e-163	1	465	1	476	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1
P40740	1.82e-123	7	465	6	468	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.60e-121	10	463	5	476	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	2.89e-119	10	463	9	476	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P26206	7.45e-119	9	463	5	460	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000240_01613.