CAZyme Information: MGYG000000240_01653

Basic Information

• Species: Amedibacterium intestinale
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Amedibacterium; Amedibacterium intestinale
• CAZyme ID: MGYG000000240_01653
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000000240_30|CGC1	56114.12	5.2524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000240	2625986	Isolate	China	Asia

• Gene Location: Start: 8414; End: 9886 Strand: +

Full Sequence      

MAFKEGFLWGGATAANQCEGAWNVDGRGPALTDVTTGGSVNSPRYVTFLDKDGKPGKIPA
HGGVLPEGAKYAVLEDELYPNHDGIDFYHHYKEDIALFAEMGFKTFRMSISWSRLYPNGD
ELEPNPKGIEFYRNVFTELKKYNIEPLVTIWHFDTPLYLEEHYGGWKNRELISFYERFVK
TCFTEFKGLVKYWLTFNEINNTVMFLDLFGGKASDEAYQNAYQHLHHQFVASARAVKIGH
EIDSENQIGCMICGITFYPLTSDPKDILANRHTWEQNIFYCGDVQCKGEYGSYAKRLWKE
HNVNLEITEQDVKDLKEGTVDIYTFSYYMSTIVTTHKVDEKVGGNFSAGAKNPYLTYSDW
GWALDPDGLTYYLEMIYDRYHKPLMVVENGLGAFDKVEEDGSIHDPYRIEYFREHIKAMD
TAIENGVDLIGFTPWGCIDLVSAGTGEMRKRYGFIYVDKHDDGTGTMKRSKKDSFAWYKK
VIASNGKDID

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	486	4.7e-147	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	489	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	490	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	7	489	10	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	488	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	490	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK22871.1	0.0	1	490	1	490
BBK23063.1	0.0	1	490	1	490
BBK62639.1	0.0	1	490	1	490
AQR94887.1	3.03e-302	1	490	1	489
AGF56149.1	3.03e-302	1	490	1	489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.62e-166	3	489	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.77e-161	5	489	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
2XHY_A	1.04e-160	1	489	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F79_A	1.07e-160	5	489	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	3.70e-156	5	489	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.89e-164	1	490	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	7.62e-163	3	489	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46829	5.67e-160	1	489	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P24240	3.87e-159	3	490	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	2.62e-158	7	489	8	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000240_01653.