CAZyme Information: MGYG000000241_01095

Basic Information

• Species: Desulfovibrio legallii
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio legallii
• CAZyme ID: MGYG000000241_01095
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228		25158.42	6.8175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000241	2654501	Isolate	China	Asia

• Gene Location: Start: 110830; End: 111516 Strand: +

Full Sequence      

MSATAFQKAHAFTALWEGGLTDHPADPGGLTNHGVSLRWVQDLARQAREECLRQQRNCAQ
CVRRATAACPCDGLDLDTDGDVDADDIRACTKAQAQVLFKKHFWDALGCAALPLPLAVVL
YDGAVNQGPARAVRQMQQAMNATGEAQLDHYTAIAEDGLMGERTAELAAALAAAGLHWYA
ARQTLRLREAFYRDLAARRPSMKAFLAGWRNRVRDLHNYLARLEREED

Enzyme Prediction     

No EC number prediction in MGYG000000241_01095.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	11	128	1.4e-29	0.9651162790697675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05838	Glyco_hydro_108	5.11e-23	11	128	2	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
COG3926	ZliS	1.04e-18	4	213	3	161	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	5.98e-18	4	128	1	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam09374	PG_binding_3	0.002	149	212	12	74	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCC85041.1	4.45e-122	6	226	5	225
AMD89012.1	4.05e-118	5	225	4	224
VZH34560.1	1.10e-115	6	227	5	226
SFV73167.1	1.29e-107	6	226	5	225
ADP87789.1	2.26e-30	5	216	6	184

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	3.29e-10	1	164	1	118	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2IS5_A	2.50e-06	17	139	17	101	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	2.54e-06	17	139	16	100	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000241_01095.