CAZyme Information: MGYG000000241_01149

Basic Information

• Species: Desulfovibrio legallii
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio legallii
• CAZyme ID: MGYG000000241_01149
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	MGYG000000241_7|CGC1	58839.58	7.6645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000241	2654501	Isolate	China	Asia

• Gene Location: Start: 46188; End: 47816 Strand: -

Full Sequence      

MAAAKEDAAAGVSLVVNLTRLGDLLQSQALITDLHRRGRRVQLVCLDNFADALSLLRHVE
RAWPLPGAQWLAALDRDWRGAAGDLLAWTRRVREVAQPQEIINLTTTLPARLLTRLLAGS
DCSVRGFDLDAEGFGRNNGVWASFLNGTTAGRLNAPFNLVDMFRMLGAPKGTASVGAAGD
AALRTPSEQTRLAALALLAAAPAESRGFVGLQLGASEARRQWPVRHFAVVGDQLWRELRL
CPVLLGAPAETSLAQEYADLANAPFCNATGRTDLPQLAAVLTQLRLLITNDTGTMHLAAG
LGVPSLALFLATAQPWDTGPYLPACCCLEPALDCHPCPYNRPCPHNLECHERISPAVAGA
LALSWCRTGRWEDAPLARNGGEVRIWLSRRDVGGFMDLRDLAGREGEDRSLWMRQQRHFW
RHILDDMDRPVPSPLPPCPVTACSPPFAHEVGAALEQAVTLLQAIAAQGALTGKSPRAGA
LLLRNCERLQNLLNGCPPLAALGGFWRELRQARGDDIAEFLQFSGKLAVYLEQWRQKLQG
LA

Enzyme Prediction     

No EC number prediction in MGYG000000241_01149.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	101	346	3.3e-43	0.9066666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	1.79e-40	14	361	3	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.09e-23	14	365	5	329	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	4.76e-18	90	344	6	242	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
TIGR02193	heptsyl_trn_I	2.66e-16	14	321	3	291	lipopolysaccharide heptosyltransferase I. This family consists of examples of ADP-heptose:LPS heptosyltransferase I, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
TIGR02195	heptsyl_trn_II	1.62e-13	204	361	172	329	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD90830.1	8.94e-206	14	534	6	540
QCC86588.1	9.16e-202	10	540	20	576
QTO40658.1	7.98e-199	11	537	12	567
SPD35034.1	1.96e-181	1	538	16	574
VZH34087.1	8.03e-180	14	522	29	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	7.56e-11	209	321	188	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000241_01149.