CAZyme Information: MGYG000000241_01332

Basic Information

• Species: Desulfovibrio legallii
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio legallii
• CAZyme ID: MGYG000000241_01332
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
602	MGYG000000241_9|CGC1	69057.42	9.2219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000241	2654501	Isolate	China	Asia

• Gene Location: Start: 10146; End: 11954 Strand: -

Full Sequence      

MSLPNEASSDAEIYPKPKHDRRLAPDIPSRGTTRRGVHQRYEAHLPVTVRDPADSAFSLR
CLSEDLSSSGMLLQWRQDVPCPSVGDKLVLKFTMPPGTLPEGYESRVRIPAVVVRLVDDI
NGEKKIAVNFTRNLDTYLLVKKWLRLIVTSIFLIALSVYAVLYMRKESVFYFMFDIPVFT
YGIIASVFLVSRFIFAFFYRNVPLDLSFTPGVSIVIPCFNEEKWIEKTIQCAINQDYPQE
KLEVILVDDGSTDKSMERVRHIEKQLREEIEGDRFIVIEQPYNMGKRHALAAGALRAKFD
LLVFVDSDSFLEPEAVREVVQPFCDPKMGAVSGRTEVQNKWTNALTKMQAVRYYVAFRFM
KAAEAVFDGVTCLSGPLACYRKDLVLRYLDDWLNQKFFGYPATFGDDRSLTNFILAHHRT
GYQDAAVCSTIVPSRMRTFMKQQMRWKRSWLRETLRASSFMWRKEPFMALSFYAGFLLPV
LAPLVVVRTMLVIPIELGLFPYKYLAGILVTSTLMSASYLLFKRSTLWPYGIIFCLFYLA
VLLWQLPVAVLTFWKSEWGTRNTSADVAAQGKRRYEQKMFVMPSDATSAEARHTDPCDRK
AS

Enzyme Prediction     

No EC number prediction in MGYG000000241_01332.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	213	385	3.4e-31	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	1.83e-51	214	387	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	2.68e-46	212	449	2	231	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06439	CESA_like_1	1.47e-40	200	447	19	241	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	2.80e-40	178	555	15	385	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	3.82e-35	168	544	5	362	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO41705.1	0.0	10	589	18	597
ARC85988.1	6.62e-198	12	573	14	609
QAZ68702.1	6.71e-196	12	566	3	550
ANY71979.1	7.82e-196	58	583	86	621
QJA08186.1	2.05e-195	12	574	3	579

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	2.37e-28	180	582	46	479	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	1.02e-27	180	582	46	479	ChainA, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
6YV7_B	1.54e-15	201	435	33	251	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	1.55e-15	201	435	34	252	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6P61_A	1.26e-12	210	388	13	183	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NKX1	2.86e-46	146	455	9	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
P0C0H0	2.86e-46	146	455	9	307	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1
Q5X9A9	3.95e-46	146	455	9	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1
P0C0H1	7.55e-46	146	455	9	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=hasA PE=3 SV=1
P0DB60	5.24e-45	146	455	9	307	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
143	162
169	191
465	487
500	522
532	554