CAZyme Information: MGYG000000241_01547

Basic Information

• Species: Desulfovibrio legallii
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio legallii
• CAZyme ID: MGYG000000241_01547
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000000241_12|CGC1	38509.27	9.5873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000241	2654501	Isolate	China	Asia

• Gene Location: Start: 6717; End: 7784 Strand: +

Full Sequence      

MKRRTALLLLMLGLLTALLVLGLLAGFVPQTEGPELRRRANPRVVSLTPADLPAPIVPLG
DGARQWAVRRPVTAASPKAGAAQGRAGPAAPHGAWPPELRAAVGEPGGFAPLLSLDGASP
PLLLGSLPPLYGDALDTGGRPLRWLTGPGTLAGYSPWQPPAPQAVAPPFTGEDASPAALH
ARAARYRRLVENFARRYDLDTDLVYAIIHSESDFSPTLVSNKSAMGLMQILPDTASDEVH
RYLYGHRGEIGFDELRVPEVNIRYGTTYLHILLTRYFAGVEDELAREYCVVAAYNMGPNR
FLRLYGATDAAAVARINTMSATELYADLTSRLPARETRFYVAKVRRMKDHYAALR

Enzyme Prediction     

No EC number prediction in MGYG000000241_01547.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	195	349	2e-21	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	4.28e-65	190	348	3	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	1.24e-36	131	351	134	356	membrane-bound lytic murein transglycosylase MltC.
cd16896	LT_Slt70-like	4.28e-35	185	349	3	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.31e-27	186	344	6	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15470	emtA	4.54e-27	182	349	35	201	membrane-bound lytic murein transglycosylase EmtA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCC84560.1	2.33e-134	1	355	1	392
AMD88640.1	4.93e-133	1	355	1	379
QTO41915.1	5.25e-130	1	355	1	410
VZH33299.1	8.27e-129	17	354	17	356
ATD80276.1	1.45e-122	1	354	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C5F_A	4.80e-28	128	351	113	338	Structureof Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli],4C5F_B Structure of Lytic Transglycosylase MltC from Escherichia coli at 2.3 A resolution. [Escherichia coli]
4CFO_A	1.27e-27	128	351	113	338	Structureof Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFO_B Structure of Lytic Transglycosylase MltC from Escherichia coli in complex with tetrasaccharide at 2.9 A resolution. [Escherichia coli],4CFP_A Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CFP_B Crystal structure of MltC in complex with tetrasaccharide at 2.15 A resolution [Escherichia coli],4CHX_A Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli],4CHX_B Crystal structure of MltC in complex with disaccharide pentapeptide DHl89 [Escherichia coli]
2Y8P_A	2.86e-21	182	349	18	184	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	3.51e-21	182	349	35	201	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GI4_B	3.96e-21	182	349	18	184	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q666M2	3.90e-32	128	351	130	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mltC PE=3 SV=2
Q1CEV1	3.90e-32	128	351	130	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mltC PE=3 SV=2
B2K0V2	3.90e-32	128	351	130	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1
Q8ZHE6	3.90e-32	128	351	130	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis OX=632 GN=mltC PE=3 SV=2
A9R6R2	3.90e-32	128	351	130	355	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975561	0.021198	0.001770	0.000166	0.000083	0.001257

TMHMM  Annotations     

start	end
7	29