CAZyme Information: MGYG000000241_01776

Basic Information

• Species: Desulfovibrio legallii
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio legallii
• CAZyme ID: MGYG000000241_01776
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40340.06	9.8638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000241	2654501	Isolate	China	Asia

• Gene Location: Start: 55643; End: 56725 Strand: +

Full Sequence      

MLLGLLLTACAKKAPTPEVEPLGPPVAMESPDFFVTYLAPRNQDLTSWKDMAPTVRKSLN
YVNTRPQGNVAVQRPGLDVTWGDLKRTLTRLQALLPRLDAEPGLLLENFRWVEVAGGINY
SGYYEPAVRASRTRKPGYTQAIYARPPELSKVLAQKGRYYDRRTIEEKQVLAGRGLELAW
AADPVDVFFLEIQGSGRLIFDDGTQAYVNYAGQNKHKYKSSGRIMREKGLLRRGDIYEQR
EWFRNNPDRVREILNENPSYVFFRFGTRGPTGAMGYQVDDWLSLATDRGFIPLGAVVAYG
VNAPDEKRGRVPLRGIGFAQDVGGAIKRNRIDIFCGGDERANYVASHLDAKGPAWVLLAK

Enzyme Prediction     

No EC number prediction in MGYG000000241_01776.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	129	264	1.3e-39	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	1.92e-65	122	360	127	366	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	2.58e-64	107	264	52	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	3.47e-58	128	265	1	158	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	2.26e-57	128	264	2	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
PRK11162	mltA	8.61e-43	116	357	114	354	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMD90327.1	2.19e-224	1	360	43	404
QTO41166.1	2.25e-223	5	360	36	391
QCC85116.1	4.48e-221	3	360	34	392
ATD81892.1	1.00e-218	5	360	3	358
SPD34632.1	1.00e-218	5	360	3	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QK4_B	4.43e-38	121	357	104	344	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
7ESJ_A	6.52e-37	121	360	103	360	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	5.91e-32	137	358	180	412	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2AE0_X	4.40e-31	116	357	94	333	Crystalstructure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold [Escherichia coli]
2GAE_A	6.21e-31	116	357	95	334	Crystalstructure of MltA from E. coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KPQ4	1.88e-30	91	357	84	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P0A935	4.73e-30	116	357	114	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	4.73e-30	116	357	114	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q8K9A7	2.04e-19	106	357	112	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000241_01776.