CAZyme Information: MGYG000000242_02106

Basic Information

• Species: Enterocloster sp000431375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp000431375
• CAZyme ID: MGYG000000242_02106
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000000242_10|CGC1	44518.48	4.6716

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000242	3795523	Isolate	China	Asia

• Gene Location: Start: 65481; End: 66623 Strand: -

Full Sequence      

MKILDRYIDQLLEKSSPSRPIWNIEKIRQGAKPSWNYMDGCMINAILELYHITQKEEYLD
FADRFIDYFVEEDGSIHSYDPKEHNLDNVNTGKTLFDLYDLTGKEKYRLAIDLVYSQLKT
QPRTSTGNFWHKEIYPNQIWLDGLYMAQPFYMQYEVTYNNSTNCKDCYQQFVNVYNLMRD
LRNGLYYHAYDDSRTSFWCDKVTGLSDNFWLRALGWYAMALIDTMEVMPEETLGSEKKEM
NRIYKELIDSMLPYQDEETGMWYQVVNRGGIHPNYLETSGSAIFAYAIMKSVRLGFLDGS
YFAYGKKAFEGICRTYLSEENGELQLGGICLVAGLGNKEMREGTFDYYMREPIVKNEAKG
VAPLILAYIELMYQHQEAEV

Enzyme Prediction     

No EC number prediction in MGYG000000242_02106.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	372	3.5e-111	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.21e-86	32	371	31	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.01e-81	35	370	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.005	42	127	473	580	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX91776.1	5.50e-221	1	376	1	375
ANU47524.1	1.11e-220	1	376	1	375
QQR03578.1	1.11e-220	1	376	1	375
QRP36827.1	5.24e-219	1	376	1	375
ASN98361.1	5.24e-219	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.41e-98	35	370	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.26e-65	35	371	39	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.37e-64	35	371	29	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	1.05e-08	35	375	66	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	7.74e-08	168	325	196	340	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.78e-64	35	371	39	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.13e-44	146	370	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.13e-44	146	370	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000242_02106.