CAZyme Information: MGYG000000243_00350

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_00350
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000000243_2|CGC1	71218.35	8.6263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 102630; End: 104519 Strand: +

Full Sequence      

MLFFPYNVNKTVFFVLLPLSIINTLQMKFIQALYLVAALSVAPVGMMAQTHSSDSYFLHT
ITKGQSLYSIASMYNVTTADIIKLNPGSSEQIKAGERLKIPQKNAGSGQQTFHTIQAGET
LYKLTQRYGVTAQHICKANPGLSAENFRIGQVIVIPAQTESSEETIINEVKSAGAVSSAS
TPLKPKCRDMHRVERKETIYSISRLYGITEAELIAANPELRTEKLKKGKFLCIPYTSAGN
SQKEQEQPVSPTTIPTDNELFDKSKKENPKIATIKAAVMLPFMTDGSGNRDEQTRMVEYY
EGFLMAVDSLKEKGVSIDIYTYDTYNNTSSVKSILAKDEMKNMNIIFGPAYPEQVKPVAD
FAKKNNIRLVIPFTSKGNEVFNNPSIYQINTPQSYLYSEVYEHFTRKFTNANVIFLDAED
GDKDKADFIKGLKEELKGKHIPFTELKGEAITPESLKGAMNATLDNVFIPTSGTNIALIK
LLPQLIVTLRDNPDYRMQLFGYPEWQTYTNDHLASFYELDTYFYSSFYTNNLFPEAIRFS
SAYRKWYSKDMSNTFPKYGMLGFDTGYFFLKGLSQYGSNLEDKLNKVTVTPIQTGFKFER
VNNWGGFINRKVFFVHFTKNYELIKLDFE

Enzyme Prediction     

No EC number prediction in MGYG000000243_00350.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	8.28e-11	111	155	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
PRK06347	PRK06347	1.14e-09	48	276	322	574	1,4-beta-N-acetylmuramoylhydrolase.
smart00257	LysM	3.56e-09	59	100	2	44	Lysin motif.
cd00118	LysM	4.06e-09	59	100	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	5.38e-09	59	101	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR40682.1	0.0	9	629	2	621
ALA74972.1	0.0	27	629	1	602
QJR68229.1	0.0	27	629	1	602
QJR60047.1	0.0	27	629	1	602
AII69224.1	0.0	27	629	1	602

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8CMN2	2.50e-08	31	217	2	175	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	2.50e-08	31	217	2	175	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1
Q4L3C1	4.58e-08	51	168	22	144	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q2G0U9	1.48e-07	31	217	2	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=sle1 PE=1 SV=1
Q7A7E0	1.48e-07	31	217	2	186	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain N315) OX=158879 GN=sle1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.889731	0.109329	0.000270	0.000194	0.000192	0.000292

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_00350.