CAZyme Information: MGYG000000243_00579

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_00579
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
889		101195.11	6.9732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 82097; End: 84766 Strand: +

Full Sequence      

MKKAIVFTALAFSAATLSAQYNINLSRVTPPSIEYLKMGNTGPKGKEIRVNNLYMDEGGI
PQLPVMGEFHYSRMHPNYWKDALLKMKASGINIVATYCLWSLHEEMEGELSWQEHLNLRR
FIQLCKEVGLKVHLRIGPYCNAEIKNGGLPDWIIGNPNFRTRSNDPLYLNYVRHWYEAIY
KQVKGLLYKDGGPIMAIQLENEYVSQGMIISHLMNLKKMAVEIGFDVPLYSMTHWMDSEY
PKGEIVPYAGFYIEAPWVTSGKEEMPTSNFEFFTYNRLSDNIGTDIIKIEGDVESLNGEN
NDSPFFTCEIGVGSTTFRHRRAVVPEELAGEMINLRLGCGANLMGYYMYVGGSNPVGEKR
TFQSSGPRINYDYQAPIREFGTLGTVMQETKKYNYFMNDFGTALAPAAAYLPTSNQNRNN
LQWAVRLHNNSGYLFCSNYLYRNSKKDYKNVQFKVKLKDETLRIPNHKITVKDGTYFLWP
FNQNMGGVQLKYATVQPICSLKEGNTRTFFFFEDDQIGGEYLLENKNIQDIKVNNGVCKA
DKNGYFINQLVPGTDCSIEITQKDGAKVRLVTLTEEESDQLWKGTIRGKEFVALTASSLI
YDEEGITLIDNNPNAEIQMYRNGRFMQKLFRHPAHDLQASIRPLRPMGYGQWIRPAGEEK
EVKRNFAIHSFAGVEQAWIRYASESNPICLLNGKEVSSTTLGDYRRADVCKLIQNGENTI
TFRFPDSTPQPIVAEIEILMTNGQRFVWHTDGTWTGASDKQPVIVVKHKETPHSFAPEEH
LALYEVNAPAPTAGEEETRMYINYKGDKANAYLNGNLVADSFYDGTDWILSLSRLKGTIE
TNPLVLRIDGLKSADANIYFEKNVNPEKCVTPTLDAIKVKQEYRFRCNR

Enzyme Prediction     

No EC number prediction in MGYG000000243_00579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	59	392	6.4e-83	0.9706840390879479

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.30e-55	67	394	14	309	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.38e-28	65	381	47	325	beta-galactosidase; Provisional
COG1874	GanA	2.24e-15	67	203	20	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.85e-06	79	203	12	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ34970.1	0.0	1	885	1	881
QCQ48325.1	0.0	1	885	1	881
QCQ52773.1	0.0	1	885	1	881
CBW24573.1	0.0	1	885	1	881
AKA53703.1	0.0	1	885	1	881

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3THC_A	3.13e-33	59	393	22	324	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.66e-33	59	393	46	348	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	8.59e-33	59	393	46	348	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
7KDV_A	1.47e-32	59	393	29	331	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
4MAD_A	4.86e-30	45	207	28	176	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q60HF6	1.57e-33	25	393	5	347	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q5R7P4	6.36e-33	59	393	45	347	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q93Z24	9.53e-33	67	394	82	397	Beta-galactosidase 17 OS=Arabidopsis thaliana OX=3702 GN=BGAL17 PE=2 SV=1
P16278	1.99e-32	59	393	45	347	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q58D55	3.02e-32	59	393	44	346	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001383	0.997479	0.000369	0.000262	0.000256	0.000242

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_00579.