CAZyme Information: MGYG000000243_00626

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_00626
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000243_3|CGC1	53249.71	5.8002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 147916; End: 149334 Strand: +

Full Sequence      

MIKKLSTLVAGLALICLTGCTSPQKGTAQNDVFSPIEVAVPERPAGQQDVIQLTTPKLDT
VRVGFIGLGMRGPGAVERWTHIPGTKIVALCDLLPENAERAQKIVTNAGMEAPVLYSGSE
DAWKQLCERNDIDLVYIATDWKHHAEMGVYAMEHGKHVAIEVPSAMTLDEIWALINTSEK
TRKHCMQLENCVYDFFELTTLNMAQQGLFGEVLHVEGAYIHNLEEFWPYYWNNWRLDYNN
ENRGDVYATHGLGPACQLLDIHRGDRMKTLVAMDTKAATGPELGKRYGLANDSIEFQNGD
HTMTFIRTENGKTILIQHDVMNPRPYSRMYQLTGTDGFANKYPIEEYCLRPDQVDAKEVP
NHENLNMHAAVPENVKEALMEKYKHPIHRELEETAKKVGGHGGMDYIMDYRLVYCLRNGL
PLDMDVYDLAEWCCMADLTRLSIENGNAPVAVPDFTRGSWNKVKGYRHAFAK

Enzyme Prediction     

No EC number prediction in MGYG000000243_00626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	57	462	2.6e-167	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.64e-20	60	385	3	303	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.05e-13	61	186	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	7.85e-08	61	158	18	129	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
PRK11579	PRK11579	3.06e-04	59	235	3	164	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY39628.1	5.37e-317	1	472	1	471
ABR38060.1	5.37e-317	1	472	1	471
ALK86643.1	5.37e-317	1	472	1	471
QUT56623.1	5.37e-317	1	472	1	471
AND18351.1	1.07e-316	1	472	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	7.42e-91	43	460	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	2.63e-68	61	464	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
4H3V_A	8.93e-08	63	244	9	190	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
3MOI_A	4.83e-07	61	212	3	145	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
1OFG_A	8.38e-07	40	212	10	179	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KX96	1.07e-317	1	472	1	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	7.43e-280	3	472	3	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	5.45e-279	1	472	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	5.45e-279	1	472	1	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	8.25e-261	3	472	4	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000093	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_00626.