CAZyme Information: MGYG000000243_01895

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_01895
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		38518.37	9.2504

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 102979; End: 104001 Strand: +

Full Sequence      

MNCYLSRNYKGLSSAGNKAKTDIEQIMKDLSFKNVGLKQTTYRNKVLSFLFTLAGVLKAP
FCLHRGDYLVLQYPLKKYFTFVCNMAHQRGAKVIVIIHDLGSFRRKALTVKQEISRLNHA
DYIIAHNEKMKKWLEDNGCKAKLGVLGIFDYLSETSAAPKQNTEKPYSVLYAGALSPRKN
AFLYEVGAFVHSFSLNLYGNGFEINQAKGKEHFNYMGFVKSDDLIATAQGDFGLVWDGTS
VSTCTGDFGEYLQYNNPHKTSLYIRCQLPVIIWKQAALADFVRENGIGICVDSLEELEKI
LNTLSEEEYAEMKKRTAKIGERLSQGYFVRKALQEAIERL

Enzyme Prediction     

No EC number prediction in MGYG000000243_01895.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	13	337	2.2e-107	0.9720496894409938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	3.78e-87	14	337	15	330	sugar transferase.
cd03794	GT4_WbuB-like	8.18e-11	49	338	82	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	1.36e-05	57	311	74	338	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.72e-04	43	340	74	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06841	PLPDE_III_MccE_like	0.005	246	324	75	132	Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE. This subfamily is composed of uncharacterized proteins with similarity to Escherichia coli MccE, a hypothetical protein that is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. ODC participates in the formation of putrescine by catalyzing the decarboxylation of ornithine, the first step in polyamine biosynthesis. DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine. Most members of this subfamily share the same domain architecture as ODC and DapDC. A few members, including Escherichia coli MccE, contain an additional acetyltransferase domain at the C-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93766.1	4.10e-134	1	340	1	338
QQT78203.1	6.76e-131	1	336	1	335
QUU07104.1	6.76e-131	1	336	1	335
QRP56553.1	6.76e-131	1	336	1	335
ASM65269.1	6.76e-131	1	336	1	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W6Q_A	7.29e-16	63	337	64	326	GlycosyltransferaseC from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_B Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_C Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1],4W6Q_D Glycosyltransferase C from Streptococcus agalactiae [Streptococcus agalactiae COH1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	1.22e-50	15	340	14	327	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
A0A0H2UR93	3.46e-21	19	340	20	333	Glucosyltransferase 3 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtf3 PE=1 SV=1
Q9AEU1	1.48e-19	19	337	20	329	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.17e-17	1	340	1	332	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	2.71e-16	10	340	16	337	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999968	0.000036	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_01895.