CAZyme Information: MGYG000000243_02703

Basic Information

• Species: Phocaeicola massiliensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola massiliensis
• CAZyme ID: MGYG000000243_02703
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000000243_21|CGC1	48496.37	6.6751

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000243	3947824	Isolate	China	Asia

• Gene Location: Start: 29649; End: 30926 Strand: +

Full Sequence      

MRHKETSKDFIMMNRNVLHLTCPPIPVLRIGFVGLGNRGILALERYMHLEGVEVKALCDL
RPRNIERATALLHRFNRPAAVAYGEEGGWRQLCGRADIDLVYICTDWLTHTDIAVYAMQQ
GRHAALEVPAAMSVADCWRLVDTAEQTRRHCMMLENCCYDAFALTTLNMVRQGALGEITH
AEGAYIHDLRRHYFADETEGGYHNNWIKLYSQQHTGNPYPTHGLGPICQWMDIHRGDRME
YLVSMSSREAGLSAYARGQFGKHSAEAAQPYLMGDVNTTLIRTVKGRTIVLQYDVTTPRP
YSRHQTVCGTKGFMQKYPVPCILLDEYGKEPLAGEDFEKVMERYKHPFTATIGEEAKRKE
MPNEMNYIMDYRLVHCLRNGLPLDQDVYDAAEWSCITELSELSVRQGSIPVEIPDFTRGN
WEGDK

Enzyme Prediction     

No EC number prediction in MGYG000000243_02703.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	25	422	1.4e-167	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.60e-20	28	201	4	176	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.26e-11	28	153	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	0.008	97	182	64	149	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY42665.1	3.67e-272	12	422	1	411
QQY39397.1	1.49e-271	12	422	1	411
ABR38319.1	1.49e-271	12	422	1	411
ALK82695.1	1.49e-271	12	422	1	411
QEW35077.1	4.28e-271	12	422	1	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	8.59e-92	23	422	38	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	2.88e-63	28	425	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
1EVJ_A	1.58e-09	33	178	8	150	ChainA, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]
3EC7_A	5.09e-09	28	185	24	176	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
1OFG_A	5.56e-09	98	178	99	179	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KY05	2.99e-272	12	422	1	411	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
Q89ZW9	1.54e-220	16	425	9	418	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4252 PE=3 SV=1
Q64XS1	6.65e-214	16	422	8	414	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0955 PE=3 SV=1
Q5LGW9	2.70e-213	16	422	8	414	Alpha-N-acetylgalactosaminidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0874 PE=3 SV=1
Q7MWF4	2.51e-141	15	422	45	457	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000243_02703.