CAZyme Information: MGYG000000244_00771

Basic Information

• Species: Catenibacterium sp000437715
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium sp000437715
• CAZyme ID: MGYG000000244_00771
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000000244_10|CGC1	55655.75	5.9007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000244	2463343	Isolate	China	Asia

• Gene Location: Start: 25099; End: 26547 Strand: +

Full Sequence      

MKKTKDILWGGATASSQYEGGYKAGGKGLDTQDCRPYLKRTSDATTSTRLLTQDIIDEAK
KCEGIGHYPFRQGSDGYHHIDEDIALLKELGIDIYRFSISWARLYPHGDEETPNEEGIKF
YDHIFKEVHKAGMKIFLTMNHYAVPLYLVEHYGGWTNRKLIEFYERFATVVFENWGEYID
YFLPFNEINAGYFSPYNGVGLVKEKDQPYNQTLVFQSLHHQFVASAKTIKIAKKLSPKSQ
SGCMVACFCYYPLTSTPEDNLKAVRDEEIHQWFAVDILANGHYPSYMDRFFRENDIHLTI
TEEDSELLKKYTCDFVSFSYYSSSIATCKEDGQQTAGNLVVSTKNPHLKASDWGWQIDPV
GLRIMLNKMYDRTQKPVFICENGLGAHDIMEDGLIHDPYRIDYLEQHFKQIDEAIDDGVD
VIGYIMWGVIDIVSAGSCEMEKRYGVVYVDANNLGQGTYKRYKKDSFKWYHDFIENKHKQ
FN

Enzyme Prediction     

No EC number prediction in MGYG000000244_00771.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	477	1.9e-129	0.9790209790209791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	2.27e-163	5	475	6	467	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	9.96e-160	5	474	8	470	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	1.54e-159	5	476	6	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	1.10e-149	5	476	6	471	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.36e-128	1	474	1	470	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL56674.1	0.0	1	481	4	485
QQY27689.1	8.87e-307	1	475	1	476
QMW73242.1	1.47e-305	1	475	1	476
QPS13501.1	1.47e-305	1	475	1	476
QUN12825.1	1.39e-262	5	476	3	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	9.39e-152	2	475	7	463	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	3.97e-142	6	476	23	480	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	4.89e-128	7	474	15	473	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	5.20e-127	5	474	10	472	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	7.59e-127	2	474	6	473	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.77e-153	7	474	12	462	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.15e-145	5	474	9	464	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	4.38e-142	7	477	8	458	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P24240	1.62e-140	5	474	6	466	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q48409	8.61e-138	7	474	8	455	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000244_00771.