CAZyme Information: MGYG000000244_01294

Basic Information

• Species: Catenibacterium sp000437715
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Catenibacterium; Catenibacterium sp000437715
• CAZyme ID: MGYG000000244_01294
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000000244_23|CGC1	56735.09	5.0093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000244	2463343	Isolate	China	Asia

• Gene Location: Start: 23764; End: 25236 Strand: +

Full Sequence      

MSIPKDFLWGSDIAASQCEGAWNLDGKSPIISDYGTVGSKAQMRMKTFIDSEGKEGIYPF
FASLPYGAHYALHDNCHYINHEAVDFYHHYKEDIALFGEMGLKTLNLTISWARIFPKGYK
NGVNQKGIEFYRSVLEECQKYQIEPLVTLQKYDTPVYLEEKIGGWLSREMVEEFYQFAKV
CLEEYKDLVKYWATFNEINSLAIPSFLPYNLPKEVSQMNLTQLHHQLVASAKVVKLAHEI
NPSNRIGCMFSSLAYYPLTCDPKDILKSQETFRDMCYYTTDVQVRGKYPYYAKSVWNKLG
VQLDITKQDEQDLLDGKVDYIAFSYYMSNCITTHQVDEEMAKGNLSIGNRNPYLEYSEWD
WAMDPDGLKYILHELYGRYEKPLLIIENGLGAEDVLTEDHQIHDEYRIEYLRKHITSMKE
AIDEGVNVIGYTTWSALDLVSASSGQISKRYGFIYVDIDDEGHGTFNRYRKDSFNWYKKV
IQTNGEDLNS

Enzyme Prediction     

No EC number prediction in MGYG000000244_01294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	485	4.1e-136	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	2	488	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	4	490	5	459	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	2.23e-176	1	488	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	4.97e-170	1	488	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.73e-155	1	488	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30116.1	1.81e-207	1	488	1	488
QUN12031.1	1.55e-203	1	488	1	488
AMC93859.1	2.19e-203	3	488	4	488
QHB24556.1	1.58e-198	1	488	1	488
QEI32059.1	1.58e-198	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.15e-149	3	488	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	6.66e-149	3	488	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.89e-148	3	488	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	3.38e-146	1	488	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3PN8_A	7.98e-145	3	488	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46130	1.20e-152	1	488	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P24240	1.30e-149	1	488	1	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	7.08e-148	2	488	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.85e-145	1	488	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	2.15e-144	3	488	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999875	0.000154	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000244_01294.