CAZyme Information: MGYG000000245_02561

Basic Information

• Species: Roseburia sp003470905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003470905
• CAZyme ID: MGYG000000245_02561
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000000245_17|CGC1	95200.71	5.1637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000245	4145433	Isolate	China	Asia

• Gene Location: Start: 18224; End: 20707 Strand: -

Full Sequence      

MDTHKFFVEKLRFHLNEPDMLVLVGWFYDGKAAGREVMAYLDGEKLPVTLTVNKGAEVRQ
KYLGTINEINEEVVGIVTLPKDWRERKKFEIFTDDGEKKKRAYAVSTKKLRVRESRLEYY
IENCHRDEDTVTVTGWCMGAGEVNLYLLDQRRQKLQVKTDHYFRKDLLSVFPECDTQAKP
GFMIQASVKRQVDDKKFFLEMRNAEHYSRTRLRKWDDGGRWQYVLEKSQDAFRYLERNGL
AATIHKIETKLAGRSETSYDAWCKKYDAGKEELDEQRKHVFSYQPLFSIVVPLYRTKPEY
LQEMIESVQAQTYGNWQLCLADGSLSGDDEDRQKDSFVTELTPVLEKYAKADARITFTTL
QKNLGISGNTNAALAMAAGDYIVLADHDDIVPANALYELADALNQDQSIDVLYSDEDKIS
MDGKKRFEPHFKPDFDLDLLCSVNYICHLFAAKKELVDMTGGFCSEYDGAQDLDFILKCC
ENAKNIRHIPKILYHWRCHMQSTAANPESKLYAFEAGRRAIEAHYDRMEIPATVENAAFY
GMYRTKYDWKEKPLVSVIIPNKDHKKDLEKCMNSILGKNTYPNIEFIIVENNSTEQETFD
YYKDLEVMHENVHVVFYEGGFNYSKINNFGADAAKGSYLLLLNNDTEMIDGGAVNEMLGY
CMREDVGIVGAKLLYEDETIQHAGVVLGFGGTAGHAFIGKPRYDTGYFGRILCAQDYSAV
TAACMMIKRSVFDEVGGLTEELAVAFNDVDFCLKVRKAGKLVVYDPYAEWFHYESKSRGY
EDSPEKVERFNDEVDILLRSWREIIEQGDPYYNPNLTLDNSDFSLRR

Enzyme Prediction     

No EC number prediction in MGYG000000245_02561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	288	413	1.1e-19	0.6647058823529411
GT2	556	736	2.1e-17	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.30e-96	285	498	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	3.74e-36	557	774	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.16e-30	553	779	3	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	2.76e-20	288	414	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.29e-18	289	414	1	113	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL08067.1	0.0	1	827	1	829
VCV23342.1	0.0	1	827	1	829
AEN97498.1	0.0	1	827	1	817
QHB25117.1	5.68e-270	4	826	3	813
QRT31219.1	5.68e-270	4	826	3	813

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.38e-136	251	825	329	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.08e-83	259	827	293	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	3.63e-09	284	514	7	231	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
A0A0H2UR96	9.72e-06	286	412	4	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000081	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000245_02561.