CAZyme Information: MGYG000000245_03495

Basic Information

• Species: Roseburia sp003470905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003470905
• CAZyme ID: MGYG000000245_03495
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	MGYG000000245_33|CGC1	96963.74	4.8789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000245	4145433	Isolate	China	Asia

• Gene Location: Start: 15583; End: 18120 Strand: +

Full Sequence      

MVQHEKFYLNGTWQLKKADETLLCPVEIPGSVLFGLTEHGLLEDPFYRMNEYPARELLKN
DFIFSREFELKKEEGRVYTLCCDGIDTVADIFINGIPVKHVDNMHLRYRILCTNILKNGT
NSIVVKIHSAISYVNEHVSAPGKEIHYTACGAMEGNQYIRKAHSMFGWDWGPQLPDMGIW
RDIYIDSYEKAELSDLHIRQEHIDGKVLLSAEVKVTLPEKAQNGKIVEAEHQVSPQSKES
HAQTLAKNAETADSLKVKITLWTPDGKQLSFSDGKCLVEDPALWWPNGYGKQPLYTVRAE
LFLGGEFLDVKELRIGLRTLTVSREKDAWGEEFAFCVNGVKIFAKGADYIPEDCIYSKIT
PERIYELLDIAVACHFNCIRIWGGGYYPADVFYDYCDEHGLIVWQDFMYACNVYELTDAL
RESIIEETKDNVKRLRHHASLGLWCGNNEMESAWDHWGGFNDHSDALKQDYLTMFEKLIP
EALKSEDDATFYWPSSPSSGGNFTDPDSDDIGDRHYWDVWHGEKPFSDYENYYFRFCSEF
GFQSFPCKKTINTFTLPEDRNIFSEVMESHQKNGSANAKILHYIAENFLYPKDFESLIYI
SQVLQAIAIKSGVEHWRRNRGRCMGAIYWQLNDNWPVASWASIDYFGRWKALQYFSRHFY
ADVLGSLKVSEDAVYTPYLQNETMQEVSSDVTVFVKNMLGEVLWKNSQRAVCEPLSVKAM
GPVSLKDVIEGRESEVFVEAVFTHSDGTLSRQVEMPKPYKHMQIKKAEITFDVMIEGDLL
TVRLKSDAPAFFVSVESNVDLVWSDNFMHLTGKEPYEITAVLPEGAEGVPKIRVRSLCDS
WEVEE

Enzyme Prediction     

No EC number prediction in MGYG000000245_03495.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	702	2.4e-106	0.663563829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.63e-109	9	797	15	763	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.72e-11	251	523	209	481	beta-D-glucuronidase; Provisional
pfam00703	Glyco_hydro_2	1.22e-09	193	318	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	2.07e-06	176	449	190	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	2.33e-06	678	761	6	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV23589.1	0.0	1	841	1	849
CBL08662.1	0.0	1	841	1	849
CBL13897.1	0.0	1	841	8	856
CBL20579.1	3.92e-289	6	818	3	811
QCU02115.1	1.11e-287	6	814	3	793

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OP6_A	5.47e-143	5	844	9	843	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	9.96e-143	5	828	7	824	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.05e-142	5	828	9	826	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.44e-142	5	844	7	841	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.16e-140	5	828	7	824	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4FZV0	9.85e-110	1	814	17	852	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
I2C092	1.11e-108	9	837	9	852	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q5B7W2	8.96e-107	9	764	9	769	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q8K2I4	5.55e-104	1	806	17	842	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
O00462	7.73e-104	7	813	23	849	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000245_03495.