CAZyme Information: MGYG000000245_03565

Basic Information

• Species: Roseburia sp003470905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp003470905
• CAZyme ID: MGYG000000245_03565
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000000245_35|CGC1	62974.5	4.8792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000245	4145433	Isolate	China	Asia

• Gene Location: Start: 22013; End: 23734 Strand: +

Full Sequence      

MPCYNSIDGEPASVSHRLLTELLRERMGFDGLCISDYGGISNAHEVQRIGETIGETGFLA
MEAGMDMEMPKAIGYGEKLKEMFRSGQADTELLDRTVLRVLEAKFRMGLFEQPFAMDGES
CKKIFEEKEGAELSLRSARESMVLLKNNGVLPLSGKIKKLALIGPHADCARKFFGGYTHL
CMMESVYAAASSIAGVEGSPESGQIGGAMLPDGEPVNYVPGTKIQSDEAELFNDILRLQK
PGCRSLLEELKERMTDTEILYVYGYPVAGKDQSRFEEALQAVREADVVILTLGGKHGTCS
MATMGEGVDAADINLPECQDAFIKAASVYGKPLIGIHFDGRPISSDTADQYLDAVIEAWS
PAETGAQAVADVLLGAYNPGGKLPVSVAYHAGQIPIYYNHPNGSAWHQQESIGFVNYVDV
PHTPRYCFGHGLSYTQFEYSDIHISTAEIGAEESVQISCVVKNAGNCAGDEVVQLYLRDR
FASMTRPVKELAGFKRIHMEPGEKVRVTFTVQADQSAFLDRQMRWKVEKGEIDVEIGSSS
EDIRLKGTYRITEDRWIDGAKRAFYAKVQKDKV

Enzyme Prediction     

No EC number prediction in MGYG000000245_03565.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.86e-108	1	544	252	758	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	1.02e-43	142	434	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.64e-37	1	511	263	742	Probable beta-xylosidase; Provisional
COG1472	BglX	1.31e-29	1	168	213	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam14310	Fn3-like	1.88e-26	471	540	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL13854.1	0.0	1	573	1	573
VCV22852.1	0.0	1	569	247	815
CBL11432.1	0.0	1	569	247	815
QRT50982.1	0.0	1	569	247	815
AHF23793.1	1.05e-226	1	566	240	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	8.50e-77	1	544	278	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.48e-76	1	544	232	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	7.70e-76	1	544	232	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.47e-75	1	540	220	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5TF0_A	3.42e-75	4	544	238	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.68e-77	1	551	252	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	4.62e-74	1	551	252	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	2.23e-71	1	546	226	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	1.29e-64	1	544	276	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P14002	7.05e-59	1	551	196	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000245_03565.