CAZyme Information: MGYG000000246_00583

Basic Information

• Species: Streptococcus pasteurianus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus pasteurianus
• CAZyme ID: MGYG000000246_00583
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574	MGYG000000246_1|CGC13	64270.56	5.0564

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000246	2159802	Isolate	China	Asia

• Gene Location: Start: 582830; End: 584554 Strand: +

Full Sequence      

MPKTVNLKQKPYQLNDQQLAWVEKTLSQLSDEEKIGQLFVNLFFFGEDAFSGNQLTNKEI
LEKYHIGGARYMNGTPEQVQTLLNDLQSHSKVPLLVAANCDSGGDGAVTGGTYISSGAQS
EASRDPWVAYHAGLVSAREEKALGVNVNFDPCVDILENWRNTIVNTRAYGTTAQDVITYT
SAYLDGLTAEGDIIQCIKHFPGDGTEERDQHLVLGVNELSPERWEESFGQVYRHHINRGV
EMIMAGHIALPHYQKELNPELTDEDILPATLAPELITDLLKTRLDFNGLVITDASHMLGM
TSAMRREDYVPRAIAAGCDMFLFFNDMEEDFNFMLKGYQEGVISKERLDDAVRRILGLKA
KLNLHIKQADGSLLKSPEELAVIGCEEHLAWQKEASQKAITLLKDTQGNLPISPETHRRI
RLYYLEGEKGGIMATNDEVLENLKQALEARGYEVTINDGNTRVKGETLTYRHNVDLALTV
ANVIGYGAQNNYRIQWKTAMSNEVPWYVHEVPTVFVSLNYTTHLHDVTMVKTAVNAYHHN
ANTIESLLDCLEGKAAFKGQANDLVWANKWQAKL

Enzyme Prediction     

No EC number prediction in MGYG000000246_00583.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	87	322	2.3e-44	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	3.35e-59	29	418	1	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.33e-51	32	358	3	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	1.87e-20	129	326	99	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	2.18e-11	16	412	32	407	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK30025.1	0.0	1	574	1	574
QCE36751.1	0.0	1	574	1	574
QIX74329.1	0.0	1	574	1	574
QTH47270.1	0.0	1	574	1	574
SNU86936.1	0.0	1	574	1	574

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	3.84e-107	10	574	9	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	6.80e-43	26	420	39	455	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.44e-42	26	420	13	429	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	3.40e-42	26	420	43	459	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	4.35e-35	29	559	11	525	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	6.37e-126	5	574	2	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	3.73e-42	26	420	39	455	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q2UFP8	1.87e-20	22	427	57	478	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
P48823	7.00e-20	59	412	57	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B8NGU6	1.35e-19	22	427	53	474	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000246_00583.