CAZyme Information: MGYG000000248_00428

Basic Information

• Species: Weissella cibaria
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella cibaria
• CAZyme ID: MGYG000000248_00428
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000000248_1|CGC6	37803.76	7.8833

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000248	2506217	Isolate	China	Asia

• Gene Location: Start: 387697; End: 388704 Strand: -

Full Sequence      

MRREYRTVCLQEWGLNSDMISNKAKLVLATTAAMAGLAIANTTQFETTASAATVQGSGYL
NDGTGWYWFENGQRYTGFRFYMGSYYWFQDGVRQENSWESAWGMSYYVGADGRAVQGVNE
INGVNYDFGNNGTFFSRGKANGYVATPSGWLWMQNGYRYTGFQFYMGTYYWFQNGARIQN
SWENAWGMTYYVDNVGRAVQGLQTIGGKQYFFGNDGTFFLRKNTKFTANGANYSADANGV
VTKLSSGSVKDQMMGFAQAWHGWDSTQQYYLDLLINYESGWNVNARNGQYVGLFQTTGIY
DMSVEGQAKVGLAYIANRYGNPQGAWNHIQAIGWY

Enzyme Prediction     

No EC number prediction in MGYG000000248_00428.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033838	PspC_subgroup_1	2.29e-09	45	239	498	680	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033840	PspC_relate_1	2.83e-06	57	196	510	627	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033930	pneumo_PspA	2.83e-06	45	201	455	604	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	3.88e-06	46	216	476	642	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
TIGR04035	glucan_65_rpt	3.55e-05	190	216	1	27	glucan-binding repeat. This model describes a region of about 63 amino acids that is composed of three repeats of a more broadly distributed family of shorter repeats modeled by pfam01473. While the shorter repeats are often associated with choline binding (and therefore with cell wall binding), the longer repeat described here represents a subgroup of repeat sequences associated with glucan binding, as found in a number glycosylhydrolases. Shah, et al. describe a repeat consensus, WYYFDANGKAVTGAQTINGQTLYFDQDGKQVKG, that corresponds to half of the repeat as modeled here and one and a half copies of the repeat as modeled by pfam01473.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APS27723.1	1.96e-254	1	335	1	335
APU65272.1	1.96e-254	1	335	1	335
APU63121.1	1.96e-254	1	335	1	335
ASS51351.1	1.96e-254	1	335	1	335
QAT25332.1	1.44e-238	19	335	1	317

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.154258	0.839809	0.003728	0.001155	0.000579	0.000443

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000248_00428.