CAZyme Information: MGYG000000248_01403

Basic Information

• Species: Weissella cibaria
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella cibaria
• CAZyme ID: MGYG000000248_01403
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482	MGYG000000248_4|CGC3	49084.38	3.9242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000248	2506217	Isolate	China	Asia

• Gene Location: Start: 153205; End: 154653 Strand: +

Full Sequence      

MGQTPTKAIIAGVAGALGVVATTQVPMVQAAVDQLANMTQDTKHVKRVSTADNAEKLKSA
HRGVTKKSDIVRAQSTSTTPQFEAVADEIPVEPSLAPVLETNSHAEIAATSEVDTPTSLS
VADDVLQSTAPVTASYVYTAPSASETSTMVSSAPATPAEQAVVSEATTATTSPADATRYT
VQDGDTLGNIATTIGVSVETIIALNPDVDLTMLQVGQIIFVPRDTATVSEVTSPVTIASD
AATSVSEVTADDYQTALAAEVADAMGEDIVVETPSMPSSAPTIVVSSATDTSTSTSVAAS
SSAAGSSSAASSVAPTTPADTTVDNTLPSTTPTAVLPVNPGNETDVVSGSLTATQRQTIV
TAALKYAGQGIPYVWGGKTPAGFDCSGLAAWVYQDAGLSLPSYTVSEESYVATTDVRTKA
DVMAVAQPGDLLFWGGHGASWHVAIYIGGGQYVAAPAPGKNVQIETVDEVNFMPNFIGSY
NI

Enzyme Prediction     

No EC number prediction in MGYG000000248_01403.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00877	NLPC_P60	7.41e-29	370	478	1	102	NlpC/P60 family. The function of this domain is unknown. It is found in several lipoproteins.
PRK13914	PRK13914	5.20e-22	140	459	163	460	invasion associated endopeptidase.
COG0791	Spr	1.82e-19	357	464	76	179	Cell wall-associated hydrolase, NlpC family [Cell wall/membrane/envelope biogenesis].
NF033742	NlpC_p60_RipB	1.02e-12	370	467	89	191	NlpC/P60 family peptidoglycan endopeptidase RipB.
NF033741	NlpC_p60_RipA	2.60e-11	370	474	340	449	NlpC/P60 family peptidoglycan endopeptidase RipA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVO65549.1	9.11e-284	1	482	1	482
QMU89441.1	5.01e-281	1	482	1	482
AWF96051.1	2.89e-280	1	482	1	482
QAT25791.1	6.80e-278	1	482	1	478
APS27226.1	2.27e-270	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B8C_A	1.44e-24	359	476	31	138	Crystalstructure of NlpC/p60 domain of peptidoglycan hydrolase SagA [Enterococcus faecium]
4FDY_A	8.66e-11	357	458	192	289	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
3NE0_A	4.20e-10	370	474	97	206	Structureand functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation [Mycobacterium tuberculosis H37Rv]
3PBC_A	4.20e-10	370	474	97	206	ChainA, Invasion Protein [Mycobacterium tuberculosis]
4Q4T_A	5.29e-10	370	474	355	464	Structureof the Resuscitation Promoting Factor Interacting protein RipA mutated at E444 [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13692	1.19e-21	359	467	405	505	Protein P54 OS=Enterococcus faecium OX=1352 PE=3 SV=2
P96645	2.81e-12	357	451	210	299	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
P9WHU2	9.69e-11	356	468	273	374	Probable endopeptidase MT2245 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2245 PE=3 SV=1
P67474	9.69e-11	356	468	273	374	Probable endopeptidase Mb2213c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2213C PE=3 SV=1
P9WHU3	9.69e-11	356	468	273	374	Probable endopeptidase Rv2190c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2190c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000533	0.998727	0.000171	0.000207	0.000178	0.000160

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000248_01403.