CAZyme Information: MGYG000000248_01422

Basic Information

• Species: Weissella cibaria
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Weissella; Weissella cibaria
• CAZyme ID: MGYG000000248_01422
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000000248_4|CGC4	54288.83	4.3242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000248	2506217	Isolate	China	Asia

• Gene Location: Start: 170372; End: 171829 Strand: +

Full Sequence      

MGLKLDSDFLWGGAIAAHQAEGAWNVGGKGVSIADILTAGAHNQPRQITDGVIAGLNYPN
HHGIYFYESYKTDLALMAEMGFKAFRTSIAWTRIFPNGDDAQPNEEGLQFYDDLFDEMNR
LGIEPVVTLNHFEMPYHLVEAYGGWSDRRVIDFFVMYAETVFNRYQDKVKYWMTHNEISN
QANLVDEAMSEFMIWTNSGLRFPEGTPTEEKLAAMVQAGHYELVASAKAVAIGHAINPEF
MIGGMLNVAPLYPASPKPADNLAVQKARQARDWFSDVHVRGAYPAEFEAFADRTGFRPDI
TDEDRAVLQAGTVDYLAISYYNSFVVKATSACDTEFEETHGFEIVPNPEVQVSDWGWAID
PQGLRYTLNELNDLYPGLPLMIVENGFGAYDEVVDGQVHDQYRIDYLKAHIAEMEKAIVN
DGIPVIGYLSWGPIDIVSAGTGEMSKRYGYVYVDLDDMGEGSGERLRKDSFEWYKQVITS
QGVTL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	482	9.3e-144	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	485	3	476	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	0.0	3	485	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	8	484	7	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	6.41e-170	8	485	7	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	1.29e-161	8	485	9	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS51829.1	0.0	1	485	1	485
APS27244.1	0.0	1	485	1	485
APU64793.1	0.0	1	485	1	485
APU62641.1	0.0	1	485	1	485
AWF96032.1	0.0	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4F66_A	3.70e-202	4	482	6	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.06e-201	4	482	6	477	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	3.55e-195	4	482	6	477	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	9.42e-181	2	485	8	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	1.01e-179	3	485	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	1.69e-180	4	485	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	5.54e-179	3	485	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	4.12e-156	4	485	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P26206	7.25e-143	9	485	9	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46130	3.19e-138	3	485	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000019	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000248_01422.