CAZyme Information: MGYG000000250_01385

Basic Information

• Species: TF01-11 sp001414325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001414325
• CAZyme ID: MGYG000000250_01385
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925		104058.52	9.2934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000250	3613289	Isolate	China	Asia

• Gene Location: Start: 274016; End: 276793 Strand: +

Full Sequence      

MNTLRRYVKNAKDVFRIIAGVIGSYAGVISNIIGTAMGILASVMVIGGIVGLCVYVKVLP
MFTEAREEVFDKLVHLSEDDFVMKEDTVVYDSKGKQVGSVNAGSYKYVKINDVSPYIYEG
YIAVEDKRFKTHGGVDLVATMRAGVSLLKHNMEITQGGSTITQQVIKNNLLTQNKSYTRK
IAEILLAPTIESKFTKAQIMEFYCNSNFYGNKCYGVGAASKYYFGKKCADLEPHEAAMLI
GLSNSPASYNPVLHPKAALKKRNSVLRIMCKEGVITPKEYKSALKKKLNIKQFSEKGGSK
ESYVMSYAIHCAAISLMEKENFKFKYVFDSKEDYQKYNKQYSKVYSEKIESIRSGGYKLY
TSINMKKQKKLQKAVDNGLSFNKEKDGDTGKYALQGAAVCINNETNYVEAIVGGRGKNDQ
YNRAYLAARQSGSAIKPLIDYTPGFESGMYSPSTIVNDHKFANGPSNAGGGYHGNVRIRE
AVARSLNTVAWQVLDNITVKYGLSFLDKLHFHNISYIDNDNMALSLGGFTEGVRVVDMAK
GFSTLANNGSYSDRTCIKKIEHVSDGVVYKNNNEKDQVYSQDAAWMMTDVLKGVFNESYG
TGRKLKLDNGQICAGKTGTTNSSKDVWFCGYTKYYTTVVWAGYDTPRAMPGASGASIPGV
IWKDYMDDIHKKLKPEDFIMPSTISLAKYDGNGNIIEGTAISGSSKRTYGMDYFSKTILS
EKADEVQVLKDKKYQKEVLKKLKNFEKRYISNIADYYDLENDYKELTDMISSIVDDDVRT
DYAVRARNKYDSLKDETVSWKKVVKAYEKQQKEENERLAEKKKNDSERALKNQIYKNKIE
LARTRIKRMHGYLYQPSNMQILIDSAKEALDACKGYSEYYNLKAMFDMYKKELEELPVKG
ESNKKNQTPTDTSEPVATEEPQEEE

Enzyme Prediction     

No EC number prediction in MGYG000000250_01385.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	94	269	5e-56	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.30e-154	107	672	4	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.69e-152	69	678	38	605	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	6.45e-127	87	716	49	760	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02071	PBP_1b	2.45e-88	107	694	149	705	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	3.66e-73	87	686	37	578	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21747.1	4.50e-266	11	878	9	859
QIX92626.1	1.28e-265	11	875	9	856
QRP41393.1	1.80e-265	11	878	9	859
ASN93939.1	1.80e-265	11	878	9	859
QQQ98855.1	2.05e-264	11	875	9	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.80e-59	89	685	10	603	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
4OON_A	1.32e-55	89	666	23	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
2OLU_A	1.55e-55	60	685	4	612	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	4.45e-55	190	644	3	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3UDF_A	4.16e-51	108	666	42	712	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	8.85e-80	64	663	35	617	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	1.48e-77	89	681	47	679	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	5.49e-76	76	666	38	594	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A5I6G4	1.46e-73	85	690	55	664	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.46e-73	85	690	55	664	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.979309	0.020539	0.000068	0.000036	0.000022	0.000056

TMHMM  Annotations     

start	end
21	52