CAZyme Information: MGYG000000250_02685

Basic Information

• Species: TF01-11 sp001414325
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001414325
• CAZyme ID: MGYG000000250_02685
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1231	MGYG000000250_10|CGC1	145694.79	8.3536

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000250	3613289	Isolate	China	Asia

• Gene Location: Start: 77634; End: 81329 Strand: +

Full Sequence      

MFINKARAKMVSGYHVLKNNARRILKRAPKMKFFYGSYYKHCPVVENRILFESFHGSTIS
DSPFYILKELLSREDADKYEIYYSTNPQDYETHKKFIEANNIPVKLVSITSYKYLKVLAT
AKYLINNSSFPVYFIKKDEQVYLQTWHGTPLKTLGKQMRKGIESMYNVQHNFLQATYLMH
PNEFTKNAIMEDYNLNPLYTGKVALSGYPRNSIFMDKEKAKEVRKQLGLEDKVVYAYMPT
WRGTSNHSVNQNAYGREVTKMMQYLDKNLKDNQILYVNFHPILKNSIQLGDYKHIKSFPA
EVDKYEFLNSVDALITDYSSVFFDFSVTRKPIILYMYDYDKYMSDRGTYFDIKELPFVKL
YELEDLKEWLVSEKILGASYDDGDYCEKFIKYDSLDAPAKMLDLVLYGKEEGMIVEDYSE
NRQKPRRIIHPQKASTKGDFEVIKQFSKDNDIVQFEKKWFRKKVSCILYDDYNYDFDYVI
ITNTTPRTYWEEFLYKLGVKSVIARLQERELKRTFPNLKVQTPYLREFYIAAEGCGTRNT
ERIPVESDIESGENGITLTVRNKERFVPLSFMLLEKDYSILCMRELSDEERKNGVIHEDF
KKWNEKMSPVGRYQLAAEFVDMESEEKFIGTFYCPEIAKKADAGAEKYDKPDAYLAPCII
EKVGDPDSIRFYEEGKVAVIPYSRNGDRTISITLRRPEKIVDEYTQAKIKKIKSSKNTCT
VYMKMRKQDGLKIKDVVLRYRSALTYDIPVKYDIKENDVHYFITAYINFAEMNLRELYWD
LRILADKHGFENEIRARFVNNYWKNKFYITNRQYSAGEGHMTFPYYTKGGCLAFLYRQDS
EYDAYSTKVKEIAASGIYVLFKPLLKRKKIWLVYEKFCSMAQDNGYYFFKYCMENLSDEE
KKNIYYVIDKKAPDYEKIKEYDDHIIQFMSLKHVLYVLAAVLYVASDSRTHLYAWRCKTS
LIRSKIDKRPIFFLQHGVTALKQVGPLFGRKGSSPMTYFATTSKFEQDIVVKYLDYSEAK
SPITGFTRWDVLEDTSTKDDKLILLMPTWRSWLEEVSDEDFLKSEYYKNYSSLLQSERLD
AILEKNDARMIFYIHPKFAGYLKNFKKTGERITLVPFGQKPLNEIMKKCHLLITDYSSVC
WDVYYQKKPVIFYQFDLDHYNNAHGSYIDMENELFGRHAYEKEELIDNIEDCINKDFALL
PDDEKNHNHYFEYIDDKNSERTYIYLKSKGY

Enzyme Prediction     

No EC number prediction in MGYG000000250_02685.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	9.04e-65	43	407	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.83e-46	25	393	1	384	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam04464	Glyphos_transf	1.13e-26	865	1223	2	355	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.67e-21	851	1229	6	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX10919.1	2.83e-106	1	521	353	866
ASU20306.1	3.91e-106	1	521	353	866
ANU71209.1	3.91e-106	1	521	353	866
QQR24919.1	3.91e-106	1	521	353	866
QJA04592.1	3.74e-105	22	521	375	866

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	2.30e-33	24	356	330	663	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	1.65e-32	24	356	330	663	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	3.84e-32	24	356	330	663	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	4.32e-34	43	388	28	381	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	1.20e-32	24	356	330	663	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
P13485	4.24e-32	2	405	340	742	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	2.16e-31	46	356	27	336	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
P46918	3.40e-30	723	1223	400	887	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000250_02685.