CAZyme Information: MGYG000000251_01142

Basic Information

• Species: Fusicatenibacter saccharivorans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter saccharivorans
• CAZyme ID: MGYG000000251_01142
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308	MGYG000000251_2|CGC11	35734.29	4.5868

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000251	3784614	Isolate	China	Asia

• Gene Location: Start: 337657; End: 338583 Strand: +

Full Sequence      

MQERIGNIELDYTYYPGEDIYSDGPIEDELLEIAKSCTESELNAEIARRKSWPVLYHFSH
IRQNILEWVPFRKTDRVLEIGSGCGAITGAIAQKAGSVTCIDLSKKRSYINAYRNRAYDN
INILVGNFQDIEENMDECYDYITLIGVFEYSKGYIGTDDPYVEMIRRIKRHLKPGGQILI
AIENRLGLKYFAGCTEDHTGVFFDGIEDYPNLQGVRTFSKKELQEIIDRAGEFETKFYYP
YPDYKFPLTIYSDEYLPKCGELKVTAYNYDRARMELFDETRVEDTLISNGLFPEFSNSFF
VRVKWGEA

Enzyme Prediction     

No EC number prediction in MGYG000000251_01142.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13649	Methyltransf_25	4.88e-16	77	176	1	97	Methyltransferase domain. This family appears to be a methyltransferase domain.
cd02440	AdoMet_MTases	6.53e-14	76	183	1	105	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
pfam08242	Methyltransf_12	1.46e-11	78	178	1	98	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam08241	Methyltransf_11	3.34e-11	78	180	1	94	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam13847	Methyltransf_31	2.17e-08	76	181	6	110	Methyltransferase domain. This family appears to have methyltransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHC23007.2	5.73e-106	1	301	1	297
QNM10216.1	2.78e-76	9	302	3	291
CBL21588.1	2.44e-74	9	302	3	291
QCU01345.1	2.84e-74	9	302	3	291
AFZ48015.1	1.34e-54	21	301	35	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000251_01142.