CAZyme Information: MGYG000000251_02061

Basic Information

• Species: Fusicatenibacter saccharivorans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter saccharivorans
• CAZyme ID: MGYG000000251_02061
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
909	MGYG000000251_6|CGC4	102577.13	4.6793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000251	3784614	Isolate	China	Asia

• Gene Location: Start: 146833; End: 149562 Strand: -

Full Sequence      

MHTICLKDNWTLTVLGKNVYDIPETPIETKVPSTVYGTLLEKGLIPDPFYRDNELDALKL
MENDFAYETEIVIGEEDRKADRLFLHFDGIDTIADVYLNGEKIGSADNMNRVWEYDITDL
VAGDAADTVYQVKVILHSPTKFIAEEDTKCPVGGSSDAMPGFPHIRKAACMYGWDWGPRL
PDAGLFREASVLAVKTARLAQVFVGQEHHVTGKTVHGNVVDSVRLTADAEIEWMPGVTDG
NVKIVMTVTSPDGKTVLTAESGSIDPLTHSAPSKNLTGLTCELRSNRVQASLTVENPELW
WPNGYGAQALYQVKVALVAEDTLDTWEKKMGLRTITVNTDPMEDEVYDEHMTGQAPDYDD
GDNMVMTNGEKKIIITDKAAKTVKGRNFAYEINGLQIFAMGADYIPEDNILTRQTRERTD
LLLKSAQEANFNSLRIWGGGYFLDDFFYDVCDERGLLIWHDFMFACASYELSDHFEENIS
TEIRQNVRRLRSHASIALWCGNNEMETQYEMLAWPKSKKQYYDYIHLYEYIIPKIVKEED
PEKFYWPSSPSSGGNYENSNAENVGDTHYWGVWHGSEPFTAYRSHHYRFLSEFGFQSFPS
LQTVKRFTEDGDRNIFSRVMEMHQRNTAANGKILNYISQTYLYPKNFDELLYCSQLLQAD
AIRYGVEHFRRFRGTCMGAVVWQLNDIWPVASWASVDYYGNWKALQYAEKKMFAPVLLSC
EEHGEIDQKPFVNTLPHPIDVSADLHVANETGEPIVGTVKWSLRRPDSSVVKEGTFEVNA
PAYGGQWMPHLDFNGQDPLEVHLTYELVVDGNVVSSGSTLFCAPKHYHFADPKLSVSVDG
DTVTVTAENFAKSVSVETENGVLRLDDNFVDMEAGTKTFRILPTADFTAKGTGVSGAYRV
RSVYETAAR

Enzyme Prediction     

No EC number prediction in MGYG000000251_02061.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	858	1.7e-90	0.7712765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.97e-88	31	719	30	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17786	Mannosidase_ig	2.15e-10	744	826	4	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam17753	Ig_mannosidase	1.11e-07	831	905	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.35e-06	221	333	16	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCK00272.1	0.0	1	905	1	814
AHF25065.1	7.21e-304	6	905	6	808
QTE69834.1	6.82e-297	1	901	1	811
QTE73768.1	6.82e-297	1	901	1	811
AEF82182.1	6.63e-283	6	905	6	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	7.16e-128	1	875	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	7.34e-128	1	875	3	825	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.12e-127	1	875	1	823	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.25e-127	1	875	3	825	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.30e-123	31	891	30	824	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	1.52e-93	31	875	32	821	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	2.11e-93	31	875	32	821	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	5.63e-93	31	875	32	821	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q95327	2.83e-91	3	717	22	692	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
I2C092	3.43e-91	4	875	7	831	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000251_02061.