CAZyme Information: MGYG000000254_00529

Basic Information

• Species: Odoribacter splanchnicus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter splanchnicus
• CAZyme ID: MGYG000000254_00529
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	MGYG000000254_2|CGC2	35409.72	9.3041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000254	4496971	Isolate	China	Asia

• Gene Location: Start: 113640; End: 114575 Strand: +

Full Sequence      

MKRQNTVIYICVIITLLNVAGLLFIACKSNSPIATASTPVQSSTSGYYSDAYMPEALTFA
GETVPLQRLDVQEALRKELIVNSYLHSHTIQILQTAPRVFQLMEPILEKNGIPEDFKYLA
VIESRLNPQAQSPAGAVGVWQFLKGTGKENGLEINNEVDERYHIEKSTEAAAAYLKKAYE
KFGSWTLAAAAYNAGAAMISRQMDLQKETNYYNLLLGEETERYVFRILALKQIMNHPELY
NFKVNTVYTFEKTETVEVKGPVKSWADFAQEQGITYKTLKRFNPWLRKTDLKNPRHKTYT
ISIPKKKELYK

Enzyme Prediction     

No EC number prediction in MGYG000000254_00529.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	100	241	7.5e-27	0.9481481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	6.96e-40	107	232	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	2.98e-17	20	307	9	314	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	2.87e-13	108	169	6	68	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	2.65e-07	97	149	3	57	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	8.89e-07	108	167	6	60	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY32428.1	7.68e-224	1	311	1	311
SNV32652.1	7.68e-224	1	311	1	311
AZS32129.1	8.42e-118	49	311	46	308
QRO51442.1	1.95e-116	49	311	46	308
QGY43333.1	6.12e-103	12	304	7	301

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	3.51e-24	71	306	77	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	3.51e-24	71	306	77	310	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000214	0.000457	0.999363	0.000001	0.000002	0.000001

TMHMM  Annotations     

start	end
7	26