CAZyme Information: MGYG000000254_00915

Basic Information

• Species: Odoribacter splanchnicus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter splanchnicus
• CAZyme ID: MGYG000000254_00915
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		76203.98	5.9301

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000254	4496971	Isolate	China	Asia

• Gene Location: Start: 172180; End: 174192 Strand: -

Full Sequence      

MKRYILVLALFAGLGLLWSCASDAEMRWKEGRWQLISQSGKTTVYLDSTMVFPELIAAYR
LDSVVKTSDYTGHAARRYEIEDELGKGVCYEVEHTRSGLPDLVQRFYFYPGKTCFFTEIE
LVGDALLACGYMAPVKTTGTPAFLQEQGQFLFVPFDNDCWVKYDVRPLAGEQLSYEVSAL
FQPRSRRGLIVGSVEHDAWKTGVRSQTDQAGSVNGVECFGGVTSALTRDTLQHGKLKGKT
VKSPKVMVGIFDDWRTGMEEYALANARIAPAPEWKQGTPFGWNSWGSIQQHINFDKAIQV
SDFFKENLQDQGFSNDSTLYIDLDSFWDNFSDEQLKEFVDHCHRNGQKAGIYWVPFTDWF
RDPERKVEGTDTPYREVYLYANGKEQSLDGAWAIDPTHPAVKKRIDYFTERFHRAGFEYI
KIDFLTHGAMEADSHADPNVTTGIQAYNQGMKYLLDAFKGKFYITQAISPVFPSHYAHSR
RIACDAFAAITDSEYTLNGLSYGWWLCNAYRFNDADHLLMFREGITEGENRARVTSGVIT
GIYMNGDDLTLAGPKVAKERVKKFFTNAEINRIARIGRSFRPVYGYRPTANGRAENFFVL
EQEQVVYVVAFNFAKDRPLEYTLAFSDLNLDPARTYSATELWSGVNEEFTMELKGQVPPA
DVQVWKIKKL

Enzyme Prediction     

No EC number prediction in MGYG000000254_00915.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.26e-16	279	563	3	292	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	1.48e-07	279	437	2	137	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	2.27e-07	587	667	9	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	3.17e-04	181	506	178	559	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR69930.1	7.93e-222	1	669	8	675
QJR74262.1	7.93e-222	1	669	8	675
QJR65668.1	7.93e-222	1	669	8	675
AND18605.1	1.59e-221	1	669	8	675
AII65845.1	2.25e-221	1	669	8	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	22