CAZyme Information: MGYG000000255_01033

Basic Information

• Species: CAG-81 sp900066055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-81; CAG-81 sp900066055
• CAZyme ID: MGYG000000255_01033
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		34459.65	8.6044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000255	3381729	Isolate	China	Asia

• Gene Location: Start: 134954; End: 135826 Strand: +

Full Sequence      

MYKQAYLIIAHRYDETFKNLLQMIDSAENDIFVHMDKKNKQFDENACRKLVKQAGLFFTE
RTRVTWGGYSQINSEMMLLEMAVSHKKYDYYHLLSGQDLPIKTNDYIRNFFISHQGKEFV
AFDKKEFDCQNRVQYRYPLQEIVGRNHKSLVGKFASIVTFVQKKLHLKRNQDICFQKGAN
WFSITDNLAKYVIERKEWIQEVFKDSLCCDEIFLQTIVVNSPFFDKVYQYVTIPNTEEAA
MRLVDWKRGGPYVFRSSDYEELLNSKMIFARKFDCDCDAEIIKKICNRGK

Enzyme Prediction     

No EC number prediction in MGYG000000255_01033.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	5	252	6.6e-52	0.948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	5.72e-17	5	251	2	231	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEB81087.1	2.03e-105	3	287	10	293
QGS37412.1	2.52e-84	3	285	2	283
QNM12695.1	5.22e-84	5	285	3	278
AXY25303.1	1.16e-77	1	285	1	284
APF22740.1	5.28e-77	3	285	4	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EJ7_A	3.03e-10	5	285	121	404	HumanXylosyltransferase 1 in complex with UDP-xylose and peptide QEEEGAGGGQGG [Homo sapiens],6EJ9_A Human Xylosyltransferase 1 in complex with peptide QEPEGSGGGQGG [Homo sapiens],6EJA_A Human Xylosyltransferase 1 in complex with peptide QEEEYSGGGQGG [Homo sapiens],6EJB_A Human Xylosyltransferase 1 in complex with peptide QEEEGSAGGQGG [Homo sapiens],6EJC_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGVGQGG [Homo sapiens],6EJD_A Human Xylosyltransferase 1 in complex with peptide QEEEGSGGPQGG [Homo sapiens],6EJE_A Human Xylosyltransferase 1 in complex with peptide PAAEGSGEQDFT [Homo sapiens],6FOA_A Human Xylosyltransferase 1 apo structure [Homo sapiens]
6EJ8_A	3.03e-10	5	285	125	408	HumanXylosyltransferase 1 in complex with peptide QEEEGSGGGQGG [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8N0V5	1.61e-09	5	274	98	369	N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase OS=Homo sapiens OX=9606 GN=GCNT2 PE=1 SV=1
Q5QQ57	1.77e-09	5	285	315	598	Xylosyltransferase 1 OS=Pan troglodytes OX=9598 GN=XYLT1 PE=2 SV=1
Q86Y38	1.77e-09	5	285	329	612	Xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XYLT1 PE=1 SV=1
Q5QQ56	2.37e-09	5	285	318	601	Xylosyltransferase 1 OS=Canis lupus familiaris OX=9615 GN=XYLT1 PE=2 SV=1
Q811B1	4.24e-09	5	285	323	606	Xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xylt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000091	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000255_01033.