CAZyme Information: MGYG000000262_01800

Basic Information

• Species: Anaerobutyricum hallii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerobutyricum; Anaerobutyricum hallii
• CAZyme ID: MGYG000000262_01800
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		23948.11	9.2003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000262	3404550	Isolate	China	Asia

• Gene Location: Start: 5234; End: 5845 Strand: -

Full Sequence      

MSNYYPDISHYHPVRNWGKVKSNCPFLIAKATQGTSYIDETLDTNIRECERRGIPYWLYA
FLNRGDETAQTRFLVEVCKERVEKHFIGYVLDVESGNTEDGVESALNYLKRQRHKMMLYT
MYSEYERYERIIRHRPKKCAWWEARYGLNDAAYRPRYSTHKGADLQQFTSNGICPGIPGR
VDLNRITGQGKKEHWFRKAGKCD

Enzyme Prediction     

No EC number prediction in MGYG000000262_01800.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	7	177	1.2e-27	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	4.70e-21	4	186	1	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	8.08e-21	7	184	4	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06524	GH25_YegX-like	2.97e-18	7	188	4	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
pfam01183	Glyco_hydro_25	1.47e-15	7	177	2	180	Glycosyl hydrolases family 25.
cd06417	GH25_LysA-like	2.24e-15	7	195	5	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUF81551.1	8.52e-149	1	203	1	203
SOB72115.1	2.75e-120	1	201	1	201
QFG05701.1	3.68e-16	7	184	11	188
VEI06837.1	7.28e-13	7	196	6	193
QBP06957.1	1.19e-12	7	188	6	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JZ5_A	1.83e-09	7	184	27	210	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]
2WAG_A	1.71e-06	7	203	20	220	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000262_01800.