CAZyme Information: MGYG000000262_02120

Basic Information

• Species: Anaerobutyricum hallii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerobutyricum; Anaerobutyricum hallii
• CAZyme ID: MGYG000000262_02120
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486	MGYG000000262_12|CGC1	57603.82	5.2113

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000262	3404550	Isolate	China	Asia

• Gene Location: Start: 107980; End: 109440 Strand: -

Full Sequence      

MNKETYLKEYPKYKNMRENVKRDKNRLHFHMMPPTGWMNDPNGLCQFHGVNHIYFQYTPF
LAGWGTKLWGHYTTKDWVHYTEEEPFLFPDTKWDRDGVYSGSACVKEDGIHYFYTGNVKL
QDKEYDYIMNGREQNTMHLFSPDGKNITVKELVMTNENYPSNMSKHVRDPKIYEKDGYYY
MIQGGRDDENRGCVLLFQSDNLKDWKWYDTVYSKQPFGYMWECPDLFEIDGQQIMTCCPQ
GVEQQGYEYQNVYQCGYFPVSFDIENKKYEFSEFTELDKGFDIYAIQTFQDEKGRRILIG
WMGIPDADYDNDATVQYDWIHALTMPRELSFKDGKLLQKPLKEMQQLRKNEFHCALSEFV
QWEPKDSCFELHIDFEERTEKNSSVKIQLREDVFLSWEKGLFRLNMGKSGHGRKERIAEI
KQLRNLTIFSDTSAIEIFINDGENVMTTRVYSENLEQKVTFLSKGNVGNVAGYELGSFVI
EKHEEK

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	30	340	4.6e-88	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd18623	GH32_ScrB-like	2.24e-152	36	333	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
TIGR01322	scrB_fam	1.59e-145	14	451	2	443	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	4.88e-132	17	470	20	477	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
pfam00251	Glyco_hydro_32N	4.37e-108	30	340	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.
smart00640	Glyco_32	1.28e-104	30	442	1	437	Glycosyl hydrolases family 32.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB72997.1	0.0	1	485	1	502
AXQ77793.1	3.77e-183	3	481	4	477
AVQ19049.1	1.11e-182	1	482	1	468
BAK29386.1	2.33e-179	3	481	4	477
ALT82805.1	2.33e-179	3	481	4	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	5.76e-62	26	461	33	472	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	1.15e-61	29	466	29	472	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	1.60e-60	26	453	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	2.32e-59	26	453	49	462	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
6NUM_A	4.68e-48	29	452	43	486	Thestructure of GH32 from Bifidobacteium adolescentis [Bifidobacterium adolescentis],6NUN_A Structure of GH32 hydrolase from Bifidobacterium adolescentis in complex with frutose [Bifidobacterium adolescentis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07819	2.49e-108	23	468	26	474	Sucrose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=sacA PE=3 SV=2
Q05936	4.61e-90	18	453	26	465	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P27217	5.74e-83	23	451	24	438	Sucrose-6-phosphate hydrolase OS=Klebsiella pneumoniae OX=573 GN=scrB PE=1 SV=3
P13394	4.36e-80	23	460	34	461	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1
P37075	1.31e-72	23	451	24	438	Sucrose-6-phosphate hydrolase OS=Salmonella typhimurium OX=90371 GN=scrB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000262_02120.