CAZyme Information: MGYG000000262_02523

Basic Information

• Species: Anaerobutyricum hallii
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Anaerobutyricum; Anaerobutyricum hallii
• CAZyme ID: MGYG000000262_02523
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675	MGYG000000262_17|CGC1	75827.87	8.8717

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000262	3404550	Isolate	China	Asia

• Gene Location: Start: 20815; End: 22842 Strand: -

Full Sequence      

MAKKISTRKTTAKSSSTAKKTSVKNAEAEVKASVKEATVEPKTVAKKEAVKPKAAVKKTA
KAKTPEKKETVEAKPEAKKEEAVKPKPAAKKKTVKAKTSEKKAAVKAKPVVKKEEAAEPK
TEVKEKTVKAKPAAKKAEVEVKEPVKKVEIETKVPAKKVAVKAEAPSKKEVAEPQTTVKQ
DIPMEQPDLGPRRSVAFIGSECYPFVKTGGLGDVMSALPKALAKLNLDVKVILPRYKCIP
QKYQEKMEYRGSFYMDLCADGKQYYVGIMEYQEDGVVYDFIDNDEFFSWGDPYTNLIDDI
PKFCYFGKAALAALNYLDWTPDVVHCHDWQAALVPLYLRTCFSDTNVGRAIAVLTIHNLR
FQGVYDRKTIQYWSGLPDYVFNKDCMIQNWLDANMLKGGITYSNKVTTVSNTYAWEIQTE
EYGEGLEEHLRYHNNKVLGIVNGIDTDIWNPATDKLLASKYDAESAIKNKKANKKALQES
LGLDVDDNKMVIGLISRLTNQKGLDLVNDVIPGIMDGNTQVVVLGTGDAQYEDTFRYYED
KYKGSFCAYIAYNENVAHNIYAGCDALLVPSRFEPCGLTQLISMRYGAVPIVRETGGLKD
TVQPYNAFENTGNGFTFDRYESGLLYDAINRAKTLYFENRVYWDDMVVRDMNKDVSWEQS
AKQYKDMYVELTPRY

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	195	668	2.7e-176	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	195	668	2	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
TIGR02095	glgA	0.0	195	671	3	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	195	674	3	466	glycogen synthase GlgA.
COG0297	GlgA	3.85e-176	195	668	3	475	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.70e-114	198	672	9	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUF81048.1	0.0	138	675	171	708
SOB71621.1	0.0	179	675	159	655
BCL59191.1	0.0	182	675	170	666
AQP38401.1	0.0	178	674	64	560
CBL39792.1	0.0	178	674	64	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	5.73e-88	195	674	12	500	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
4HLN_A	1.88e-87	185	668	117	622	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
1RZU_A	6.35e-87	194	671	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	3.86e-86	195	671	3	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.33e-85	195	671	3	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	2.78e-160	193	671	2	478	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	5.72e-157	193	671	2	478	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
A6M334	7.23e-132	195	672	3	476	Glycogen synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=glgA PE=3 SV=1
B2V049	3.48e-129	195	674	3	478	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
A0PY73	1.42e-128	194	671	2	475	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000262_02523.