CAZyme Information: MGYG000000263_03069

Basic Information

• Species: Blautia_A sp900066335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp900066335
• CAZyme ID: MGYG000000263_03069
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	MGYG000000263_17|CGC2	85516.91	4.6757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000263	3712893	Isolate	China	Asia

• Gene Location: Start: 59044; End: 61335 Strand: -

Full Sequence      

MKKEKIQELISRMTLEEKAGMCSGADFWHLKGIERLGIPQVMVTDGPHGIRKQAEEADHL
GINESEKAVCFPAGCATASSFDRDLIRRQGEILGQECQAMNVSTILGPAMNIKRSPLCGR
NFEYYSEDPFVSAEMAAAMIEGVQSKHVGTSAKHFVANNQEKRRMTNSSDMDERTLREIY
LASFEGAMKKSKPWTVMSSYNRINGKFVGDSKEYLTDILREEWGFDGYVVSDWGAVNDRV
SSLSAGLDLEMPPGDYENDRLIVKAVQEGKLDEKTVDLACERILDVIFRYTENRDENAVF
EYEKDHKAAADIAAECMVLLKNDNHILPLNAEKKIAFIGKYAREPRYQGGGSSHINSWKV
ESALEAAKAIPELANVTFAEGYQDEKDEVVKDLQDEAVRTAADADVAVLFLGLPDNFESE
GYDRKHMELPNCQNELVQKILEVQKHVVVVLHNGSAVLMPWKDQVEGILEAYLGGEAVGR
ATAEILAGKKNPCGRLAETFPLRLEDTPCYLTYGKGFDNADYQEGVFVGYRYYTSRKMKT
AFPFGYGLSYTTFEYSDFQLDKKEMSDKDTLEVSVKVKNTGNRAGKTVVQLYVEAPETEV
VRPVRELKGFEKIFLEAGEEKTVTFTLDERAFAYWNTLIHDWYAEEGTYKVMIGENADQM
CKGEEITVHTTKELPKTYSLNTCLGELMRDPKAQAVMGPFMQGMAQNDAAKDMAEAQEND
TSGAVNQEMMAAMMEGMPLRQLLSFVPGIKREMLEQMVDALNA

Enzyme Prediction     

No EC number prediction in MGYG000000263_03069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	252	1.5e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.33e-111	6	654	38	751	beta-glucosidase BglX.
COG1472	BglX	4.12e-73	26	353	48	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.45e-66	317	530	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	5.10e-64	3	628	50	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.90e-42	35	286	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30267.1	0.0	1	762	1	762
QHQ63232.1	0.0	4	762	4	754
AWY99215.1	4.55e-309	3	762	2	755
QUI21624.1	1.25e-308	6	762	2	754
AHF25022.1	7.77e-307	6	762	10	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.49e-285	6	762	5	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.34e-192	10	742	9	724	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.20e-136	4	657	2	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.85e-135	4	657	2	702	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.52e-131	1	674	1	840	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.16e-284	6	762	5	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	6.37e-186	10	759	9	750	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	3.59e-185	10	654	9	658	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.25e-136	5	660	45	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BB53	3.54e-128	6	653	6	816	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000263_03069.