CAZyme Information: MGYG000000264_00518

Basic Information

• Species: Exiguobacterium sp003467445
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp003467445
• CAZyme ID: MGYG000000264_00518
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
230	MGYG000000264_1|CGC7	26005.81	4.6826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000264	2830712	Isolate	China	Asia

• Gene Location: Start: 468146; End: 468838 Strand: -

Full Sequence      

MKRFILRLTGLMLVIVLCLGAIGWFGQHDKVNNALYRAYYGDHGIPSVHRNVYKDAATTY
DVDWRLLAAVHRVETIFSHSSSMRSSVGAIGPFQFMPRTWLGWQYDTEDQKGDVPEDEVD
LTDLALIEQYGGLGRDGDNDGIADPHSLVDSAHAAAYYLSEHGGTTSDSNDSIRNAIFEY
NRSEQYVKDVMSFYESYQTNVSYLPDDGSTASQQVARYTIRYLEWFAGWV

Enzyme Prediction     

No EC number prediction in MGYG000000264_00518.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	200	7e-20	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	9.88e-19	60	192	1	104	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	1.28e-05	88	163	194	240	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	0.002	53	195	4	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	0.003	56	181	4	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPI69013.1	2.02e-133	1	226	1	226
ACQ69264.1	2.02e-133	1	226	1	226
QUP88467.1	2.02e-133	1	226	1	226
QUE87803.1	2.63e-131	12	227	1	216
QZY88020.1	1.50e-73	3	201	2	200

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.846623	0.091296	0.059600	0.000282	0.000224	0.001985

TMHMM  Annotations     

start	end
5	27