CAZyme Information: MGYG000000264_00592

Basic Information

• Species: Exiguobacterium sp003467445
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp003467445
• CAZyme ID: MGYG000000264_00592
• CAZy Family: CBM50
• CAZyme Description: Cell wall-binding protein YocH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		26906.58	10.2091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000264	2830712	Isolate	China	Asia

• Gene Location: Start: 535519; End: 536304 Strand: -

Full Sequence      

MKKPLLTLTALAGLSLGVAAPASAASTHTVQSGDTLYRIAVNNGVSVNDIKQANGLNSNM
IYPNQVLKLAKSEAKASSSKASTYTVKAGDTLYRIATNNGVSVNQLMTWNGLKSDLIFPG
QQFSVKGANAASVANNAPTAKPKASTSSPVTKQSTSTTQTQAPASGKTMTVEATAYTPYC
AGCSGITATGIDVRSNPNQKVIAVDPSVIPLGSKVWVEGYGEAIAGDTGGAIKGNKIDIL
MPTQEQALNFGRKSITIKVLN

Enzyme Prediction     

No EC number prediction in MGYG000000264_00592.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3584	3D	4.27e-48	166	259	16	109	3D (Asp-Asp-Asp) domain [Function unknown].
cd14667	3D_containing_proteins	2.21e-38	171	260	1	90	Non-mltA associated 3D domain containing proteins, named for 3 conserved aspartate residues. This family contains the 3D domain, named for its 3 conserved aspartates, including similar uncharacterized proteins. These proteins contain the critical active site aspartate of mltA-like lytic transglycosylases where the 3D domain forms a larger domain with the N-terminal region. This domain is also found in conjunction with numerous other domains such as the Escherichia coli MltA, a membrane-bound lytic transglycosylase comprised of 2 domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, corresponding to the 3D domain and Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial LTs, which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond.
PRK06347	PRK06347	9.94e-24	22	148	402	546	1,4-beta-N-acetylmuramoylhydrolase.
PRK06347	PRK06347	1.57e-23	23	148	328	477	1,4-beta-N-acetylmuramoylhydrolase.
pfam06725	3D	2.82e-20	200	261	1	72	3D domain. This short presumed domain contains three conserved aspartate residues, hence the name 3D. It has been shown to be part of the catalytic double psi beta barrel domain of MltA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUE85347.1	1.18e-147	1	261	1	260
QUP88530.1	1.48e-146	1	261	1	262
ACQ69197.1	1.48e-146	1	261	1	262
QPI69077.1	1.91e-142	1	261	1	262
ANU16064.1	6.99e-92	1	261	1	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WLI_A	5.01e-10	185	260	38	113	StationaryPhase Survival Protein YuiC from B.subtilis [Bacillus subtilis subsp. subtilis str. 168]
4WLK_A	7.23e-10	185	260	59	134	StationaryPhase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168],4WLK_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168]
4WJT_A	7.35e-10	185	260	59	134	StationaryPhase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168],4WJT_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168]
2MKX_A	8.79e-10	84	126	7	49	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
4UZ2_A	2.66e-06	83	121	4	42	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34669	3.08e-62	1	261	1	287	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1
P37546	1.19e-34	166	261	312	407	Putative cell wall shaping protein YabE OS=Bacillus subtilis (strain 168) OX=224308 GN=yabE PE=2 SV=2
Q4L3C1	3.73e-23	14	128	16	134	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=sle1 PE=3 SV=1
Q8CMN2	4.81e-23	2	127	3	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=sle1 PE=3 SV=1
Q5HRU2	4.81e-23	2	127	3	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000313	0.998816	0.000194	0.000246	0.000220	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000264_00592.