CAZyme Information: MGYG000000265_00522

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_00522
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		95355.83	6.7533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 647358; End: 649937 Strand: -

Full Sequence      

MMIKMSISRLLFCSSLFLSGISVFAQELPYKQPNLPIEERVNDLLSRMTLEEKVTQIRHI
HSWNIFNGQTLDTEKLKAFSKGMSWGFVEGFPLTGANCRKNMQLVQKFMVENTRLGIPVF
TVAESLHGSVHEGSVIYPQNVALGSTFSPELAYRKAAMITKDLHAQGMHQVLAPCIDVVR
DLRWGRVEESFGEDPILCGLFGIAEVKGYMDNGISPMLKHYGPHGNPLSGLNLASVECGL
RDLHEVYLKPFEMVIRNTSVLAVMSTYNSWNRIPNSASHYLLTEVLRNQFGFKGYVYSDW
GAIEMLKTLHYTAHNSEEAAMQAFTAGLDVEASSNCYPLLADLIKEGKLDEEILNESVRR
VLYVKFKMGLFEDPYGERYAHCKMHPQEGVQLSKEISDESVVLLKNENGLLPLNAEKLRS
VAVIGPNADQVQFGDYTWSRNNKDGVTPLAGIRQLLGDKVTVRYEKGCSLVSLDTSGIKK
AVEVARQSEVAIVFCGSASAALARDYKSSTCGEGFDLNDLNLTGAQSQLIKEVYETGTPV
VLVLVTGKPFTISWEKKHIPAILTQWYAGEQAGNSIADILFGKISPSGRLTFSFPQSTGH
LPVYYDYLPSDKGFYKNPGSYETPGRDYVFSSPDPLWAFGHGLTYTSFVYKSMETDKEHY
DPTDTIYVKVDIKNTGKRSGKEVVQLYVRDKVSTVVTPVKQLRDFEKVLVEAGSTRTVRL
KVAVKDLYIVDAGNRRIVEPGEFELQVGTASDNILQSKTVIVGDFERSASAEGMKVAKSS
KNISIHGEVRDVQATLIAGVNIYAGSSGKLLGQSDDKGQYRIDAGNHEILVFRKKGYQSL
EVPVDNLGIINVRINYGEN

Enzyme Prediction     

No EC number prediction in MGYG000000265_00522.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	111	331	2.9e-61	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.27e-152	18	766	13	763	beta-glucosidase BglX.
COG1472	BglX	1.10e-87	48	461	1	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	4.21e-78	5	748	6	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	4.16e-68	401	645	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.03e-57	49	362	1	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64332.1	0.0	13	858	22	872
QQA30647.1	0.0	30	857	29	857
QUT62191.1	0.0	30	857	29	857
QUT33795.1	0.0	30	857	29	857
BCA51778.1	0.0	26	858	23	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.49e-176	30	762	7	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.17e-175	30	762	7	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	1.86e-125	30	762	36	785	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.04e-118	41	758	14	748	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.62e-118	41	758	14	748	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.57e-128	112	751	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.41e-113	4	751	3	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
Q56078	7.39e-108	41	756	38	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	2.92e-106	41	766	38	763	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
A7LXU3	1.10e-85	37	761	35	775	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000429	0.998889	0.000193	0.000160	0.000149	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_00522.