CAZyme Information: MGYG000000265_00769

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_00769
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1109	MGYG000000265_2|CGC9	124368.05	4.8726

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 305017; End: 308346 Strand: -

Full Sequence      

MKNILLFTLLLCCVTLRSQTYSIYPIPQKTTMNGNSIEMTREVNLIKEPGINEMISNRIQ
EVLTNAGINFTISDVFTDDKTNILIGINGSKGTADNYTSDHSLSKDVFTVTSNKFDPYLL
QINKNHNKGDILILGDNSGSAYYGLATLEQILEQADNNHLSTATFEDYAHTQYRGIVEGF
YGHPYSVESRLSLLDYCKRYKMNMFVYGPKADPYHAGKWREDYPSTLTDQQRYMGLITQD
DLRSLAAKAKACNVDFVWSIHPALEGGGINFSNLDPGIEDIIHKFDALYKLGIRHFGVSI
DDMNGHPYNQSELADKTQTKLYEKFNKTGVTEDDKVGPLLFVPTQYALNYGTGTLSAFKN
IHKDVVVAFTGYDCFSNIRGSACDRMADLIGRNPVMWWNNPVNDDYDEFLYMHGLTARWS
IEDKSPVSSLQGLILNPMNQGQASKIALFGAADYSWNPSKFNESDNWEASLASIVKEPEL
QDALKTFINIVSAYTTHDTRTPEGEKFAPLYTAFQSSYSKGNVPDATELINEMKKANAAC
KLLESLKESENQEYNLFYEDIKSWLAKVESMTDIVVKSISFMKNNAGLSAWTDFAEVQAK
AQKIHNDSAFLLSVFEGKGTSTYEVFKEVQPTPKYLDPFVDFLADKIKDYAPQLPDRSRE
MEIITNIYNLSGVSIETNDMTLLSGLNTVTLKPEEYVGIYFNAIKEVAVEFLPTNLTSTL
STEYSMNGKEWSTFIPDHSIAQEMAYFRIKNKSKSTHAIPINEISFRMPASESSIPINVT
TNMGTYQTYNIKNVIDGNYATKFWSDKAQKAGEYIQLDFGSSAARYQITLHFTEGDTPTG
EAQIQFSDDTQSWTTISTFTSSDISDKLYTCNANGRFARYVRLYLQSVGGGDWFQLAEFE
VTGARITPVAEDNEGNPVALLDDRSLSSGYKGKGEGHIIYRFIENIAINEIQIFHNSMFT
SASAKPTIMIYSNGKWIAKGELDAPCTSVPVSDLKNISQLKISWNKDNIPVLYEIMPIGE
PYVEEVSPPTGILSETSSSNASIFIEGNYVRIESRILIERIIITDLSGQKIKDINVNQNS
IEIPIHEKQVLIVNAYLNNNKTVTAKVAR

Enzyme Prediction     

No EC number prediction in MGYG000000265_00769.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	174	488	3.8e-75	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.97e-124	174	487	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	6.79e-10	788	898	11	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	4.05e-08	20	167	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
cd00057	FA58C	0.001	795	903	29	143	Substituted updates: Jan 31, 2002
NF033708	T9SS_Cterm_ChiA	0.009	1058	1107	1	53	T9SS sorting signal type C. The sorting signals of type IX secretion systems (T9SS) in the CFB bacteria are long, compared to other prokaryotic C-terminal sorting motif-containing signals, including LPXTG, PEP-CTERM, and GlyGly-TERM, and they seem to contain multiple motifs. A few T9SS substrates, including ChiA, have a variant form of T9SS sorting signal that may score poorly to both TIGR04183 (type A) and TIGR04131 (type B), depend on T9SS for secretion, but are released from the cell rather than left anchored to the cell surface.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77745.1	0.0	1	1025	1	1026
BCI64753.1	0.0	2	1107	5	1112
AHF13697.1	1.58e-315	17	1093	21	1099
AHF13792.1	4.97e-229	14	1109	2	1245
QFQ11845.1	2.15e-137	19	1077	22	1100

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PWI_A	1.61e-78	17	584	30	566	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
6PV4_A	3.35e-62	21	603	32	611	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PV5_A	7.86e-55	22	593	41	589	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2VVN_A	8.08e-54	2	733	5	691	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	3.53e-53	2	733	5	691	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	2.96e-66	21	916	39	953	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	4.42e-53	2	733	5	691	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.29e-45	25	533	48	525	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.80e-44	25	533	48	525	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q8VIJ5	1.09e-16	175	462	63	337	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.999187	0.000182	0.000138	0.000127	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_00769.