CAZyme Information: MGYG000000265_01578

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_01578
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000000265_4|CGC7	92116.86	4.7277

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 389801; End: 392296 Strand: +

Full Sequence      

MKKNLFLCLLFLLGILNVSAQTTGNKGFKLNVNSGDAYLDCGDITQLNKAGAYTIEAWVN
ITLDELADRFIIFKKEQPDERNRIKVQVEKNGQIYVMQANGDGAYAQTSAGCYPKSGWHH
VALVYDGTKSSTDEGVIILYIDGIRQSFSNAFFKPTTGDIDASFVLGGASLACYDEVRVW
NKSLSLETISKWKSYKVLDTHPDKANLVAYYDFQNVTDTNVPDLQGAYPATFKATEAEVK
NIDLKIFEEVGEMTIESSMVSQKTGNAYAKEDNIELLTLKVNTVGAGELALTGLDFSLNG
TTKLTDIATINVYYAGDKAQITDESLTMNYQALRPGTGKLELRDGDNAGKQPLSVGNNFF
IVAIRLKPTATDGNKLDGQITKLYFSNGKDVVPESSDPDGDMTIRQINKLDAAAYTQKCT
DYNNKIVFGWFPWFSVTTIDKVDWKGLTHIAPIGFEIDKGGYTPTFEDKGIDLKWPWIDF
INAAHKNGVKVLAAITGNVRDGGNTAFYVDLFGDSQKMRTAAVAIAKFVDKYNLDGINMD
IEEFYNSVPNHGAKYNELAKYIKEELDKINPDFELSIATYPGNESNEWDFKGMLKSADYL
TIMMYNIGQTFTCPLNDAQRRIKQFWLDIDIPASDIVIAWPYYGNIYKNGSKFGTATLGD
VPKYAKDNDITWDDAAKCNVYKYTEDGANMVAYAEDLQSLRLKYDYTTKGGFKGIGIWAL
GQDAGMEDQAYGLIREFYDSTYQGTGISKNQSNGNISVYPTAVEDELFINLKDNDGANVT
VTVYNMMGQALKNINLASGVRSVHLNSLSTGCYVVKIQCESEVASFRVVKK

Enzyme Prediction     

No EC number prediction in MGYG000000265_01578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	436	729	2.2e-38	0.8918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	2.57e-28	430	723	6	307	Glycosyl hydrolases family 18.
pfam14873	BNR_assoc_N	7.75e-27	259	389	5	149	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.
smart00636	Glyco_18	2.34e-25	425	723	1	334	Glyco_18 domain.
cd02874	GH18_CFLE_spore_hydrolase	8.81e-24	445	723	24	305	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd00598	GH18_chitinase-like	3.10e-18	426	608	1	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74334.1	0.0	1	831	1	833
BCI62990.1	0.0	1	831	1	831
APF19670.1	1.57e-27	401	738	48	387
QXP64021.1	4.29e-27	424	830	68	485
AKQ46918.1	2.97e-23	404	829	56	498

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GZU_A	1.66e-10	484	752	105	404	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.82e-10	484	752	356	655	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000271	0.999044	0.000186	0.000161	0.000157	0.000150

TMHMM  Annotations     

start	end
5	24