CAZyme Information: MGYG000000265_01935

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_01935
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000000265_6|CGC2	39474.18	6.583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 63185; End: 64195 Strand: -

Full Sequence      

MKVSHIIGIVLFFFMAGMVSCKETVKQSFKEPSALKVKKNVFINDSGKIVRLCGVSFSDP
DKLKKENQWNLRYFEEARRWGCNVIRLPIHPYTWRYRGVEDYLKILDQGVEWARQTNMYV
IIDWHAIGNLPENVYPHFNYATNWAETINFWKIIAEHYKGNSTVAFYELFNEPCDQGKPL
SWDAWQPLMEQLIDSINMIDDQKVYLVAGMNWAYLLDEVVQKPVDRNNVAYVTHPYPQKV
DAPWEDKWERNWGHVADHYPVVATEMGYVVKGQRGEHIPCIGDEKYGEAIINYLDKKGIS
YTVWCFDPSWAPALLDDFDFNLTRQGEFFKRKLQMK

Enzyme Prediction     

No EC number prediction in MGYG000000265_01935.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	42	317	3e-118	0.996415770609319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.70e-29	80	308	36	270	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.54e-17	73	310	78	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI63367.1	5.57e-160	1	334	1	332
AHM60064.1	5.72e-107	23	334	6	320
AXP79804.1	3.11e-106	35	334	29	331
QMU30925.1	3.54e-106	1	334	1	335
QJW90914.1	6.24e-106	35	334	28	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A8N_A	1.42e-94	27	331	43	357	Crystalstructure of the native form of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
4HTY_A	2.36e-94	35	331	52	352	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
5A8O_A	4.03e-94	27	331	43	357	Crystalstructure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with cellotetraose [Saccharophagus degradans 2-40],5A8P_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide B [Saccharophagus degradans 2-40],5A8Q_A Crystal structure beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A obtained by soaking [Saccharophagus degradans 2-40],5A94_A Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_B Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_C Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_D Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_E Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A94_F Crystal structure of beta-Glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 1 [Saccharophagus degradans 2-40],5A95_A Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_B Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40],5A95_C Crystal structure of beta-glucanase SdGluc5_26A from Saccharophagus degradans in complex with tetrasaccharide A, form 2 [Saccharophagus degradans 2-40]
5A8M_A	1.14e-93	27	331	43	357	Crystalstructure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_B Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40],5A8M_C Crystal structure of the selenomethionine derivative of beta-glucanase SdGluc5_26A from Saccharophagus degradans [Saccharophagus degradans 2-40]
4XZW_A	4.23e-16	35	333	12	302	Endo-glucanasechimera C10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19570	2.63e-14	60	327	94	398	Endoglucanase C OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celC PE=3 SV=1
P22541	2.35e-13	35	304	116	369	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P15704	2.68e-11	35	333	47	335	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
P19424	3.97e-10	60	304	256	519	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
A0A0U4EBH5	4.19e-10	54	304	72	328	Cellulase CelDZ1 OS=Thermoanaerobacterium sp. OX=40549 GN=celDZ1a PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000487	0.174583	0.824679	0.000094	0.000077	0.000067

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_01935.