CAZyme Information: MGYG000000265_02034

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02034
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770	MGYG000000265_6|CGC5	87793.36	6.0602

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 223566; End: 225878 Strand: +

Full Sequence      

MIKKSLAAITGLMLTVLTYASNEQAHWITAFENQSASNTWICFRKDMLIDSLPQEDIHLK
IAADSKYWMWINGRLAVFEGSVKRGPNPSDTYYDEVDISSFLKEGNNSIAILLWYFGKEG
FSYQPSGKAGLYVKSLSGSLNLNTDKQWLSTLHPGYYTPAGAQPNFRLSESNIGYDARIF
PEDWIIQPTGNLTYPWAPAIEVGTEGSAPWNKLHPRIIPLWKDYGKKEYPDSQWHQGNEV
DTLICRLPYNMQLTPCIELEAPEGKVITMYTDDYKGGGVYNLRGEYITKGGQQSYESLGW
INGHSVYYLIPKGVEVLKTEYRETSYDTSFAGTFNCNDDFFNRLWQKAQRTLLVTMRDTY
MDCPDRERAQWWGDEVIESGESFYALCPKSHLLMKKGMYELMGWQQDNGIIFSPIPSSNY
HTELPGQMLASIGRYGFWNYYLNTGDRIPVEDLYDAVKRYLHVWQYNPDGTIKFRSGDWT
WGDWGTNIDIEGLFNAWYYLALEGTAQMAEVLDKKEDATNLKEEMRLLKDAFNQAYWNGA
AYKANSTIPHPDDRLQALAVISGLADESKYEAIRNLFRKYEYASPYMEKYVLEALFVMNQ
PEEALARMKKRFESMVNHPTLTTLFEGWGLGPQGFGGGTYNHAWSGGGLTLLSQYVCGVS
PVKPGFKEFSVFPQMGNLIHAETSLLTVNGRISISLERTDGRIQMHLTVPENTQALLPIK
PEIKRIEVNGRSVYKNGKFRSNKYCRPEYSSTNQIAIKVSSGVWKVTMSQ

Enzyme Prediction     

No EC number prediction in MGYG000000265_02034.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	282	716	1.3e-87	0.8809523809523809
CBM67	25	210	5.6e-28	0.9943181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.31e-32	331	656	3	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.29e-12	658	731	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	0.001	439	574	350	504	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	0.001	438	543	109	217	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61942.1	0.0	1	769	1	767
AGY53286.1	1.60e-277	24	765	27	769
ASB50049.1	5.78e-273	24	764	24	766
QQT79846.1	3.28e-268	5	737	13	735
QRP59702.1	3.28e-268	5	737	13	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.69e-21	315	714	294	699	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	1.10e-17	22	232	5	207	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	4.74e-07	331	737	730	1148	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000395	0.998878	0.000197	0.000170	0.000160	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02034.