CAZyme Information: MGYG000000265_02114

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02114
• CAZy Family: PL30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	MGYG000000265_6|CGC7	88934.92	7.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 346416; End: 348803 Strand: -

Full Sequence      

MKRIQTCLILIGLLCISNLYATDNEKAETIRRLRQEFTTHINGTPVTAYTLQESLALIDA
EGRFTDKRAEEEVIIRNNYAAGTNMAHCIQINNLTRDCFERLQVIAESYRGKKNLDPQDN
GVQTLLRGIAFYGKMENERNNDAPGRFHASCFATPRAAVKIYFALLDLMDRIETGEVKDS
TALVAHQKLFDVGFQSWTQPYRHDETDKNVVSVERFRKHVWWVGGNALDYRPVLEAAVMM
SSVPMIDVLAEVAIRSLSVVSQTTYDEAFWTEGTTADGAGWGHGKQCLVWGYPIDGLKGT
FRILKYLQGSPWAKQLSRENVEVVLNYIRCSAFYHHKGIIPPLVDRGNMTRKNNRRGNVP
SHILAKTLLADWRSSLTPEEVKELKQFVDESSRQDVQMASAPDGYYHGTRYFYNNDDLIK
KTNDYYLFINMGSVRVDGLESAYPGAAGYNLYSADGVTLFQHDGSEYRNITGAMKLTAWP
GVTTRQTPTELHPIENWSGYTSSYDFAAGATDGKGDFATGFIYQKINAKMKGDPDVSEAK
DVNKDIYGVRAYKSYFMFDDIFLALGAGITNLSPEKKGSITTTIEQTYSPVAPEMVKKGK
ISWIRHEGFTYGVIPQQTSGDVKWNREERATNWQRLCKANTEPETTVPVFQMEIVHGREI
KDATYAYVVDCKGEFPQKIPAILANTPHLQAAENPKGTKLGAVYFDTSVTAKGKFGTFRI
SSPAALFAEKKDGKLILTVTDALMKKDLNSLTVYTSVPVRGEGVSKQSKNIYEIKIPLPA
GAHCGQPATVTLELL

Enzyme Prediction     

No EC number prediction in MGYG000000265_02114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL30	51	741	4.6e-218	0.9957865168539326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	5.32e-55	29	741	1	692	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam02278	Lyase_8	1.02e-40	409	669	1	247	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	1.68e-05	683	745	1	62	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam08124	Lyase_8_N	1.54e-04	99	370	62	300	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74347.1	0.0	1	795	1	795
QUT37261.1	9.58e-188	23	793	44	821
QQA29924.1	8.48e-186	23	793	44	821
QUT61434.1	8.48e-186	23	793	44	821
BBK86575.1	8.48e-186	23	793	44	821

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000287	0.998893	0.000300	0.000159	0.000170	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02114.