CAZyme Information: MGYG000000265_02313

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02313
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000000265_7|CGC5	72579.5	6.2134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 244859; End: 246787 Strand: +

Full Sequence      

MKAIFYSLILFCCLGCRTEKEWTLASPDGAVRFVATQIPEGEGTTILQYSVYCGDSLVIN
PSRLGLVMDGIEYGKDARPAGKAVVKTMNEPYELKAGKQLRTVNACREMTIPFEGFQLIV
RAYDDGIAFRYAFTQEDDGKQHTITDELTEFSVPANGKAWIHPYDWNERHKPSYEQYSKN
GIAINTEASHGRGWAFPMLFNTNDCWMMITEAYLDGSYPATHIDNSGKNKAYKIRFPEIE
EPVVPDAVEPVSTFPWYTPWRAIIVGKELNTVFRTQMVSHLNPPSVIGDDSWVLPGRASW
SWWYTGGTTRDYKTQIKHVDFNHAMRWEYVLIDAGWQRMDNGGTMEDVVKYAGEKGVGVW
LWYHSGAGREMDSIPTHRLMSDPVLRRAEMERISRLGVRGIKVDFFDTDKQRIIQLYPAI
LKDAAEFYLLVDLHGATLPRGFERTYPNLMTTEAIRGAETLGRQERCDRAAEHNATVPFT
RNVVGSMDYTPVTFSNKIRQGVPAIRQTTVAHQLALAVVFESGFQCYADRIEAYEELPRM
PKLFLKDVPAVWDESQLLAGYPSDFAVVARRKGKVWYVGGINGKNEERELEFSLPEACKE
LSSTWITDGKDKDSFGNEVISVIDGKVKVKLLANGGFAGTIR

Enzyme Prediction     

No EC number prediction in MGYG000000265_02313.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	11	641	6.6e-166	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.42e-81	289	549	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	2.50e-52	26	284	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	9.19e-22	552	642	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58470.1	0.0	2	642	3	648
QUT90417.1	0.0	2	642	3	648
QDO71139.1	0.0	15	642	18	648
ALJ60417.1	6.41e-214	17	640	31	654
AYB33649.1	3.94e-207	4	637	11	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XFM_A	2.88e-93	49	636	40	637	Crystalstructure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_B Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_C Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron],5XFM_D Crystal structure of beta-arabinopyranosidase [Bacteroides thetaiotaomicron]
3A24_A	1.09e-64	26	642	6	641	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	1.37e-63	26	642	20	655	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
2D73_A	7.66e-41	18	642	19	724	CrystalStructure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2D73_B Crystal Structure Analysis of SusB [Bacteroides thetaiotaomicron VPI-5482],2ZQ0_A Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron],2ZQ0_B Crystal structure of SusB complexed with acarbose [Bacteroides thetaiotaomicron]
3WFA_A	9.59e-41	24	642	5	704	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D7CFN7	5.94e-82	19	638	32	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
Q8A6L0	3.54e-70	2	642	3	662	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
G8JZS4	1.39e-42	7	642	8	724	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000313	0.999731	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02313.