CAZyme Information: MGYG000000265_02345

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02345
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000265_7|CGC6	47195.14	5.6121

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 296010; End: 297239 Strand: +

Full Sequence      

MKIKTGLLSLMIVCGACSRTTQPADVLKDNFDFASGQLNFAFSEIDQVKSAFTEEQKEKM
LVSPRNIEPDGSLHLVASRDWCSGFFPGELWYMYEYTGNEYWRQKAEEFTAPIEREKTNG
RTHDMGFKVFCSFGNGYRLTHNSDYKGILIESAETLITRYKPNVGCIRSWDHNKDKWQCP
VIIDNMMNLELLFWAYKQTNREEFYDIAVNHARTTMKNHFRDDYSSYHVIDYDTISGEVL
KKNTHQGYAHESAWSRGQAWGLYGYTMCYRETNLPEFLEQAKHIANYIFTSKTLPEDLIP
YWDFNAPNIPDEPRDVSAAAVIACALYELSMYDKDNAVQYKEWADTIVSNLSKNYRAALN
GDRGFLLLHSTGSAPHKSEIDVPIVYADYYFLEALLRKSKLEKEGNAVL

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	77	397	5.8e-133	0.9817629179331308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.62e-14	80	397	28	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO71123.1	6.17e-233	1	409	1	407
ALJ58451.1	2.51e-232	1	409	1	407
QUT90436.1	7.18e-232	1	409	1	407
QUT48710.1	1.81e-205	1	409	1	402
QUT26295.1	6.83e-204	2	406	11	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.59e-118	62	403	54	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.37e-53	75	400	62	391	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.47e-53	75	400	63	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	6.26e-53	75	400	63	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	2.41e-52	75	400	63	392	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	3.59e-120	73	401	69	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	8.01e-54	70	400	56	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	2.45e-52	75	400	63	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9RC92	1.57e-51	70	400	29	366	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	1.42e-50	22	400	15	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000062	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02345.