CAZyme Information: MGYG000000265_02480

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02480
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		43302.29	4.9605

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 164378; End: 165517 Strand: +

Full Sequence      

MEKIKTTLIGAGYRGKQLLQFLQNFPFFEVMAVADPYIEETDIPEIVCYNNGEEDYLNML
DRHKPELVFITSPWQCHVNHAIQCVERQCHIALEIKGGLYLDEYQPLIDLAEQKNCRVFP
LENTLFRRDILALCNMVNAGVFGEIIYMRGGYRHDLRSLLLDDSGNIGHRGKTESVWRSK
FYQSENGDLYPTHGLAPLCMIAGINRTDHFKSLTSLASKSAGLLQRIKDLGGDTNVEIRM
GDIVSTQIETEKGILISLIHDTTLPRPRSLDFEIQGTKSIWQGDNSRIYVEGVSPDETWE
PDLSYIERYESLYWQQWGGDALLQDAHHQGMDYIMLKALEADLQGKLVYPATLNDLALWT
SVSPWSKVSIAERKTIYFQ

Enzyme Prediction     

No EC number prediction in MGYG000000265_02480.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	374	3.4e-106	0.9523809523809523

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	7.26e-18	1	278	1	254	Predicted dehydrogenase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	1.18e-212	4	376	10	382
QUT33801.1	1.73e-208	1	376	1	376
QQA30653.1	1.73e-208	1	376	1	376
QUT62197.1	1.73e-208	1	376	1	376
QRO24037.1	1.51e-157	1	377	1	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	3.76e-76	2	376	19	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	9.38e-38	1	372	40	423	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	2.06e-75	2	376	19	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
A6LB54	1.75e-68	3	371	49	441	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	3.64e-68	9	371	58	443	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
B2FLK4	7.15e-68	2	371	32	425	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4FN60	2.81e-54	2	361	59	420	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02480.